Tap / click on image to see more RealViewsTM
£17.70
£2.95 per sheet of tissue paper
 

2022 Periwinkle Blue Damask Old World Tissue Paper

4.8 out of 5 stars rating
3184 Total Reviews |
by
Qty:

Other designs from this category

About Tissue Paper

Sold by
Tissue PaperCreate your own from scratch

Size: 25.4 cm x 35.56 cm (10" x 14")

When you've gone through the trouble of finding the perfect present make sure it has the perfect presentation. Give your gifts a personal touch with custom tissue paper printed with your chosen artwork or text. Gift giving just went from fun to super-fun!

  • Dimensions: 25.4 cm L x 35.56 cm W (10” L x 14” W)
  • Full colour edge-to-edge print
  • 4535g (10lb) paper is great for wrapping jewellery, small gifts and party favours
  • 8164g (18lb) paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

2022 Periwinkle Blue Damask Old World Tissue Paper

2022 Periwinkle Blue Damask Old World Tissue Paper

2022 Periwinkle Blue Damask Old World Tissue Paper Periwinkle Damask Old World Tissue Paper 2022 Periwinkle Damask Old World Tissue Paper Damask old world design, damask motif element created by Kristie Hubler, in the 2022 Colour of the Year periwinkle blue, with lighter tone / tint of periwinkle for a background colour. Similar design at https://www.zazzle.com/damask_old_world_cream_yellow_tablecloth-256334957129875231 with different colour damask repeat and background colour. Thank you! Kristie Hubler http://zazzle.com/store/fabricatedframes/products fabricatedframescom@gmail.com damask, "old world", pattern, Mediterranean, periwinkle, vintage, "gift wrap", "tissue paper", blue
FabricatedFrames
Pro
Artwork designed by
Deptford, NJ, United States
View their Store

Customer Reviews

4.8 out of 5 stars rating3.2K Total Reviews
2860 total 5-star reviews177 total 4-star reviews55 total 3-star reviews31 total 2-star reviews61 total 1-star reviews
3,184 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Erica E.3 May 2024 • Verified Purchase
Custom 14.8 g/m² Tissue, Size: 25.4 cm x 35.56 cm (10" x 14")
The application of this decoupage paper was very simple , applied with PVA glue on a plywood surface. The colour stayed true to paper before application . I used cling film to apply over ply wood , no wrinkles , very pleased with the result.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Adele D.24 April 2023 • Verified Purchase
Zazzle Reviewer Program
I used this paper to decopague an old chest of drawers. Paper was a good quality and adhered to painted surface well. Has dried really well with no shrinkage causing splits. Printing quality as good as expected
Original product
5.0 out of 5 stars rating
5 out of 5 stars rating
By Erica E.1 July 2025 • Verified Purchase
Custom 26.6 g/m² Tissue, Size: 25.4 cm x 35.56 cm (10" x 14")
I am very pleased with the quality and clarity of this decoupage paper . Very easy application , will purchased again from this designer on Zazzle . .

Tags

Tissue Paper
damaskold worldpatternmediterraneanperiwinklevintagegift wraptissue paperblue2022
All Products
damaskold worldpatternmediterraneanperiwinklevintagegift wraptissue paperblue2022

Other Info

Product ID: 256705250458015326
Created on 18/01/2022, 20:27
Rating: G