Tap / click on image to see more RealViewsTM
£7.65
£2.55 per sheet of tissue paper
 

2022 Periwinkle Blue Damask Old World Tissue Paper

Qty:
Heads-up!
Sorry, this product is completely sold out.

Other designs from this category

About Tissue Paper

Sold by

Size: 25.4 cm x 35.56 cm (10" x 14")

When you've gone through the trouble of finding the perfect present make sure it has the perfect presentation. Give your gifts a personal touch with custom tissue paper printed with your chosen artwork or text. Gift giving just went from fun to super-fun!

  • Dimensions: 25.4 cm L x 35.56 cm W (10” L x 14” W)
  • Full colour edge-to-edge print
  • 4535g (10lb) paper is great for wrapping jewellery, small gifts and party favours
  • 8164g (18lb) paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

2022 Periwinkle Blue Damask Old World Tissue Paper

2022 Periwinkle Blue Damask Old World Tissue Paper

2022 Periwinkle Blue Damask Old World Tissue Paper Periwinkle Damask Old World Tissue Paper 2022 Periwinkle Damask Old World Tissue Paper Damask old world design, damask motif element created by Kristie Hubler, in the 2022 Colour of the Year periwinkle blue, with lighter tone / tint of periwinkle for a background colour. Similar design at https://www.zazzle.com/damask_old_world_cream_yellow_tablecloth-256334957129875231 with different colour damask repeat and background colour. Thank you! Kristie Hubler http://zazzle.com/store/fabricatedframes/products fabricatedframescom@gmail.com damask, "old world", pattern, Mediterranean, periwinkle, vintage, "gift wrap", "tissue paper", blue

Customer Reviews

4.8 out of 5 stars rating2.9K Total Reviews
2668 total 5-star reviews165 total 4-star reviews48 total 3-star reviews24 total 2-star reviews42 total 1-star reviews
2,947 Reviews
Reviews for similar products
5 out of 5 stars rating
By Erica E.3 May 2024Verified Purchase
Custom Tissue Paper - 15 gsm (10lb), Size: 25.4 cm x 35.56 cm (10" x 14")
The application of this decoupage paper was very simple , applied with PVA glue on a plywood surface. The colour stayed true to paper before application . I used cling film to apply over ply wood , no wrinkles , very pleased with the result.
5 out of 5 stars rating
By Hayley C.24 May 2020Verified Purchase
Custom Tissue Paper - 15 gsm (10lb), Size: 45.72 cm x 60.96 cm (18" x 24")
Zazzle Reviewer Program
I knew this would be stunning but it's even better than I expected! Really happy with my design and chuffed I picked this one. Be prepared to wait though if you choose the slowest delivery, took 3 weeks to come, but arrived within stated timeframe. Perfect imagery, colour and print, so easy to use the offcuts for spare bits...I only planned on doing the two back panels of my tv unit but ended up doing three other gaps!
5 out of 5 stars rating
By D.29 July 2022Verified Purchase
Zazzle Reviewer Program
High quality paper, beautiful design and perfect for decoupage. High quality and bright colours.
Original product

Tags

Tissue Paper
damaskold worldpatternmediterraneanperiwinklevintagegift wraptissue paperblue2022
All Products
damaskold worldpatternmediterraneanperiwinklevintagegift wraptissue paperblue2022

Other Info

Product ID: 256705250458015326
Created on 18/01/2022, 20:27
Rating: G