Sell on Zazzle
Tap / click on image to see more RealViewsTM
£8.45
per sheet of 20
 

Adorable Birthday Elephant in Blue Party Hat Square Sticker

4.8 out of 5 stars rating
26756 Total Reviews |
by
Qty:
Shape
Square Stickers
+£0.40
+£0.40
+£0.40
Size
Paper Type

Other designs from this category

About Stickers

Sold by
Sticker
Create your own from scratch

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Adorable Birthday Elephant in Blue Party Hat Square Sticker

Adorable Birthday Elephant in Blue Party Hat Square Sticker

An adorable baby elephant is celebrating his birthday with gifts and balloons in the African grasslands. Perfect for a boy's birthday party or even a baby shower. Add your own customised text.
Floral Boutique Bedding, Home Decor, and Gifts
Pro
Artwork designed by
Las Cruces, New Mexico, United States
View their Store

Customer Reviews

4.8 out of 5 stars rating26.8K Total Reviews
23270 total 5-star reviews2212 total 4-star reviews524 total 3-star reviews299 total 2-star reviews451 total 1-star reviews
26,756 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous8 September 2025 • Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5 out of 5 stars rating
By Carolyn S.17 August 2020 • Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Tim S.23 October 2017 • Verified Purchase
Zazzle Reviewer Program
Brilliant quality stickers perfect for Branding my business products. Perfect printing, excellent quality paper and finish.

Tags

Stickers
birthdaypartieskidsanimalssafarijungleelephantboysstickersparty favours
All Products
birthdaypartieskidsanimalssafarijungleelephantboysstickersparty favours

Other Info

Product ID: 256239498761027028
Created on 25/05/2024, 19:36
Rating: G