HALLOWEEN SPOOKTACULAR!   |   Up to 40% Off Invitations, T-Shirts & Party Supplies!   |   Ends Soon!   |   Use Code: PARTYFUN4U40   |   See Details

Art Nouveau Roses Motif in Pink and Green Messenger Bag


per bag

  • Back Open
    Back Open
  • Front
  • Front Left
    Front Left
  • Back Right
    Back Right
  • Back
  • Back Left
    Back Left
  • Front Right
    Front Right
  • Bottom
  • Front Open
    Front Open
Art Nouveau Roses Motif in Pink and Green Messenger Bag
Designed for youby Artform Nouveau
More (4)
Fluorescent Pink
Fluorescent Pink
Select an option:
- £42.25
- £19.60
+ £16.40
About This Product
  • Sold by
Size: Rickshaw Medium Zero Messenger Bag

The versatile Rickshaw Medium Zero Messenger Bag is perfect for the daily commute, overnight stay or long-haul flight. Printed with your custom designs and with a interchangeable accessories system, this bag can be unique inside and out. It's made with a focus on environmental sustainability so combines form, function and a small ecological footprint.

  • Water resistant, extra durable (machine-washable)
  • Large main compartment and two front pockets
  • Lightweight and forms to your body
  • Quick-adjust cam shoulder strap
  • Velcro strips accessory system; Holds a 13" laptop (w/optional sleeve)
  • Made with a sustainability focus in San Francisco, USA
  • Dimensions 27.9 cm x 45.7 cm x 15.2 cm (11" h x 18" w x 6" d)
  • Designer Tip: To ensure the highest quality print, please note that this product's customisable design area measures 49.7 cm x 98 cm. For best results please add a 6.4 mm bleed.
About This Design
available on or 50 products
Art Nouveau Roses Motif in Pink and Green Messenger Bag
A pretty Art Nouveau inspired messenger bag in the style of Charles Rennie Mackintosh, the Scottish artist, designer and architect. An almost circular border of leaves and stems encompasses two pretty pink flowers.
HALLOWEEN SPOOKTACULAR!   |   Up to 40% Off Invitations, T-Shirts & Party Supplies!   |   Ends Soon!   |   Use Code: PARTYFUN4U40   |   See Details
There are no reviews for this product yet.
Have you purchased this product? Write a review!
Messenger Bags



art nouveau

charles rennie mackintosh







All Products:
rosesflowersart nouveaucharles rennie mackintoshpinkgreenwhitefemininevintagefloral
Other Info
Product ID: 210979259409812148
Created on
Recently Viewed Items