Tap / click on image to see more RealViewsTM
Sale Price £1.75.  
Original Price £2.50 per card
You save 30%

Baby Girl Shower Invitation Coquette Bow Aesthetic

Qty:
Choose Your Format
Squared
+£0.20
+£0.24
+£0.24
+£0.24
+£0.24
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+£1.35
+£0.55
+£0.55
-£0.15
+£0.55

Other designs from this category

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from twelve unique paper types, two printing options, and six shape options to design a card that's perfect for you.

  • Dimensions: 12.7 cm x 17.8 cm (5"x 7") (portrait or landscape)
  • Standard white envelope included
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Two printing options available: Standard and High-Definition
  • 12 unique paper types and colours to choose from
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 cm x 17.8 cm (5"x 7"). For best results please add 0.15 cm (1/16") bleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Baby Girl Shower Invitation Coquette Bow Aesthetic

Baby Girl Shower Invitation Coquette Bow Aesthetic

Celebrate your little one in style with this coquette-inspired baby shower invitation featuring soft shades of pink, a delicate lined background, and a charming bow design for that timeless feminine touch. Perfect for moms-to-be who love the romantic coquette aesthetic, this invitation blends elegance, sweetness, and modern charm. Whether you’re planning a classic pink baby shower, a girly tea party theme, or a stylish bow-inspired celebration, this design sets the tone for a beautiful gathering. The blush tones and dainty details make it a versatile choice for baby girls, while the pretty bow motif adds a touch of vintage-inspired grace.

Customer Reviews

4.8 out of 5 stars rating11K Total Reviews
9943 total 5-star reviews796 total 4-star reviews129 total 3-star reviews62 total 2-star reviews115 total 1-star reviews
11,045 Reviews
Reviews for similar products
5 out of 5 stars rating
By J.16 March 2020Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Nicely curated for a baby shower tea party . This design was exactly what I was looking for . Very good quality hard back prints .
5 out of 5 stars rating
By L.19 September 2022Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Thank You, i ordered this invitation as a gift to my friends who are having a babyshower. I would advise to place order early so it arrives on time. im sure i ordered it about 6 weeks before event and it arrived around 10 days after i purchased it which was still enough time before the event. I am really happy with how the invitation turned out and excellent value for money. would use this seller again x. Really Nice, exacly how i wanted it. Due to data protection no image to show :)
5 out of 5 stars rating
By Isabela S.28 January 2019Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Cannot fault anything about my invites! They're absolutely perfect!!! Excellent quality, arrived quickly, really good price and superb and efficient service! Would 100% recommend and will definitely be shopping here again! You will not be disappointed! Beautiful printing! Excellent quality card and looks just like the picture on the website!!

Tags

Invitations
pinkbowcoquettebabyshowernewarrivaldaintyfemininevintage
All Products
pinkbowcoquettebabyshowernewarrivaldaintyfemininevintage

Other Info

Product ID: 256578938762529566
Created on 22/09/2025, 11:50
Rating: G