Tap / click on image to see more RealViewsTM
£6.45
per sticker
 

Big Eye Vampire Halloween Pumpkin Molly Harrison

4.9 out of 5 stars rating
37 Total Reviews
|
by
Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 10.16 cm x 10.16 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 10.2 cm L x 4.12.7 cm W
  • Design Area: 10.2 cm L x 10.2 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Big Eye Vampire Halloween Pumpkin Molly Harrison

Big Eye Vampire Halloween Pumpkin Molly Harrison

Pumpkin Pixie and October Woods © Molly Harrison Fantasy Art www.mollyharrisonart.com

Customer Reviews

4.9 out of 5 stars rating37 Total Reviews
34 total 5-star reviews2 total 4-star reviews0 total 3-star reviews1 total 2-star reviews0 total 1-star reviews
37 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Debra S.10 July 2024Verified Purchase
7.62 cm x 7.62 cm Custom-Cut Vinyl Stickers, Matte White
A+ Love these stickers! All my friends know if this sticker is on something it belongs to me. They are great quality. They don’t peel and are water resistant. I give them away as gifts and they are grilled to receive. Printing is first class! Colors are beautiful and don’t fade or peel. The design is nice on the eyes and decorate all kinds of things.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By GINA A.27 July 2020Verified Purchase
7.62 cm x 7.62 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The sticker paper is sturdy, the colors are vibrant, and the adhesive is strong. Sticker is exactly what I wanted. Perfect for me to express both sides of my personality, cute and creepy, every day. Very satisfied with my purchase! The image is clear and cleans. The colors are vibrant.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By r.28 April 2025Verified Purchase
7.62 cm x 7.62 cm Custom-Cut Vinyl Stickers, Glossy White
I bought a couple of glossy stickers, and they turned out great. The quality and design are on point.
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
big eyehalloweencutefairyvampirevampiresartacrylicjackolanternpumpkins
All Products
big eyehalloweencutefairyvampirevampiresartacrylicjackolanternpumpkins

Other Info

Product ID: 256369293795243476
Created on 18/04/2019, 15:09
Rating: G