Tap / click on image to see more RealViewsTM
Sale Price £1.87.  
Original Price £2.66 per card
You save 30%

Black White Simple Minimalist Elegant Wedding Invitation

Qty:
Choose Your Format
Squared
+£0.20
+£0.24
+£0.24
+£0.24
+£0.24
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+£1.40
+£0.60
+£0.60
-£0.15
+£0.60

Other designs from this category

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from twelve unique paper types, two printing options, and six shape options to design a card that's perfect for you.

  • Dimensions: 12.7 cm x 17.8 cm (5"x 7") (portrait or landscape)
  • Standard white envelope included
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Two printing options available: Standard and High-Definition
  • 12 unique paper types and colours to choose from
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 cm x 17.8 cm (5"x 7"). For best results please add 0.15 cm (1/16") bleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Black White Simple Minimalist Elegant Wedding Invitation

Black White Simple Minimalist Elegant Wedding Invitation

Celebrate your love with this Modern Black & White Minimalist Wedding Invitation, combining sleek design with natural elegance. Featuring clean lines, a refined serif typeface, and a tasteful white leaf motif at the base, this invitation is ideal for contemporary couples who appreciate understated beauty. With a solid dark background and elegant white typography, the design is both modern and timeless. The minimalist border and leaf accent add a subtle organic touch—perfect for garden weddings, modern ceremonies, or eco-conscious celebrations.

Customer Reviews

4.8 out of 5 stars rating33.4K Total Reviews
29359 total 5-star reviews2933 total 4-star reviews517 total 3-star reviews236 total 2-star reviews310 total 1-star reviews
33,355 Reviews
Reviews for similar products
2 out of 5 stars rating
By Anonymous18 October 2025Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Ordered from the same collection but the colours are mismatched. Really disappointed in the products .
5 out of 5 stars rating
By L.4 August 2022Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
So happy with the outcome! They are absolutely perfect, just what I imagined and more. Will be rrcommending this site to family and friends. Thank you. Printing was clear and visable. I was a little worried as one side was blue but it turned out great.
5 out of 5 stars rating
By Mitchell B.11 March 2025Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Absolutely stunning design and beautiful finish 😍 got them for our big day in September! Can’t wait to get the matching evening invites, guestbook and table name cards!👌🏻 big thank you!!

Tags

All Products
minimalistcontemporaryelegantstylishsimplesleekchicfashionabletrendysophisticated

Other Info

Product ID: 256748467101373100
Created on 27/09/2024, 8:23
Rating: G