Tap / click on image to see more RealViewsTM
Sale Price £2.00.  
Original Price £2.66 per card
You save 25%

Black White Simple Minimalist Elegant Wedding Invitation

Qty:
Choose Your Format
Squared
+£0.20
+£0.24
+£0.24
+£0.24
+£0.24
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+£1.40
+£0.60
+£0.60
+£0.60
-£0.15

Other designs from this category

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from multiple unique paper types, printing options, and shapes to design a card that's perfect for you.

  • Dimensions: 12.7 cm x 17.8 cm (portrait or landscape)
  • Standard white envelope included
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 cm x 17.8 cm. For best results please add 0.15 cmbleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Black White Simple Minimalist Elegant Wedding Invitation

Black White Simple Minimalist Elegant Wedding Invitation

Celebrate your love with this Modern Black & White Minimalist Wedding Invitation, combining sleek design with natural elegance. Featuring clean lines, a refined serif typeface, and a tasteful white leaf motif at the base, this invitation is ideal for contemporary couples who appreciate understated beauty. With a solid dark background and elegant white typography, the design is both modern and timeless. The minimalist border and leaf accent add a subtle organic touch—perfect for garden weddings, modern ceremonies, or eco-conscious celebrations.

Customer Reviews

4.8 out of 5 stars rating33.5K Total Reviews
29483 total 5-star reviews2936 total 4-star reviews527 total 3-star reviews242 total 2-star reviews330 total 1-star reviews
33,518 Reviews
Reviews for similar products
2 out of 5 stars rating
By Anonymous18 October 2025Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Ordered from the same collection but the colours are mismatched. Really disappointed in the products .
5 out of 5 stars rating
By L.4 August 2022Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
So happy with the outcome! They are absolutely perfect, just what I imagined and more. Will be rrcommending this site to family and friends. Thank you. Printing was clear and visable. I was a little worried as one side was blue but it turned out great.
5 out of 5 stars rating
By Mitchell B.11 March 2025Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Absolutely stunning design and beautiful finish 😍 got them for our big day in September! Can’t wait to get the matching evening invites, guestbook and table name cards!👌🏻 big thank you!!

Tags

All Products
minimalistcontemporaryelegantstylishsimplesleekchicfashionabletrendysophisticated

Other Info

Product ID: 256748467101373100
Created on 27/09/2024, 8:23
Rating: G