Tap / click on image to see more RealViewsTM
£9.85
per sheet of 20
 

Boston Skyline American Flag Square Sticker

Qty:
Square Stickers
+£0.40
+£0.40
+£0.40

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Boston Skyline American Flag Square Sticker

Boston Skyline American Flag Square Sticker

Boston City Commonwealth of Massachusetts apparel for Boston Cityscape loving people. The perfect apparel to express your love to the beauty of the city of Boston. A design for City loving people especially towards Boston, one of the beautiful city of United States . This is for Boston Lover and America Lover as will. This apparel is perfect to wear or gift to your sons, daughter, love ones, relatives, friends and especially Boston citizens, to show themselves also how they like the City.

Customer Reviews

4.8 out of 5 stars rating27.4K Total Reviews
23667 total 5-star reviews2234 total 4-star reviews572 total 3-star reviews351 total 2-star reviews531 total 1-star reviews
27,355 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous8 September 2025Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Tim S.23 October 2017Verified Purchase
Zazzle Reviewer Program
Brilliant quality stickers perfect for Branding my business products. Perfect printing, excellent quality paper and finish.

Tags

Stickers
bostonboston cityskylinecityscapeflagamericaamerican citycommonwealthmassachusettsusa
All Products
bostonboston cityskylinecityscapeflagamericaamerican citycommonwealthmassachusettsusa

Other Info

Product ID: 217249558558379806
Created on 02/10/2020, 15:40
Rating: G