Tap / click on image to see more RealViewsTM
£55.82
each
 

Bottlenose Dolphins Ocean Fish Guest Book

Qty:
10.5" x 8.25" (26.7 cm × 21 cm)
-£12.42
+£24.84
Lined White 70# Uncoated Text

Other designs from this category

About Guest Books

Sold by

Style: 10.5" x 8.25" (26.7 cm × 21 cm) Guestbook

Crafted with meticulous attention to detail, these guest books are designed to elevate your special occasions, capturing memories with style and grace. The guest book features a cover made from premium paper, exuding an aura of elegance. The cover is further enhanced with a luxurious velvet lamination, adding a tactile charm that begs to be touched and admired. Inside, you'll find a harmonious blend of quality and aesthetics. The white lined pages are crafted from 100gsm uncoated text, providing a smooth surface that welcomes every stroke of the pen with grace and finesse. These pages serve as the canvas for your guests' heartfelt messages, well wishes, and memories, ensuring every word is captured with clarity and precision. For a touch of contrast, optional black pages made from 90gsm Eclipse paper create a striking backdrop for metallic and gel ink pens, allowing your guests' words to shine brightly against the darkness.

  • Dimensions: 21cm x 26.7cm (8.25" x 10.5") (100 Pages)
  • Cover: 150gsm Mohawk uncoated text with velvet lamination
  • Internal Paper: White lined and unlined pages: 100gsm uncoated text, Black unlined pages: 90gsm Eclipse

About This Design

Bottlenose Dolphins Ocean Fish Guest Book

Bottlenose Dolphins Ocean Fish Guest Book

Gorgeous Ocean Underwater scene by Ronald Heinrich with Bottlenose Dolphins, Turtles and Fish with crashing waves and island Palm Trees above the waterline is on this Guest Book. Image is public domain due to released copyright.

Customer Reviews

4.8 out of 5 stars rating739 Total Reviews
671 total 5-star reviews35 total 4-star reviews10 total 3-star reviews9 total 2-star reviews14 total 1-star reviews
739 Reviews
5 out of 5 stars rating
By Patty f.5 March 2019Verified Purchase
Size: 10.5" x 8.25" (26.7 cm × 21 cm), Paper: Lined White 70# Uncoated Text
Creator Review
The Book itself is absolutely wonderful. Sturdy and shiny and wonderful. I am actually going to use it as a journal which is why I removed the Guest Book words myself. Easy to add yourself it you want them back on. The Box it comes in just makes it a wonderful gift. Great Book. The printing turned out perfect. The colors are exactly like the image, the Dolphins swim towards you almost like in 3D. Great job printing!!!
from zazzle.com (US)
Reviews for similar products
5 out of 5 stars rating
By Laëtitia J.21 April 2019Verified Purchase
Size: 10.5" x 8.25" (26.7 cm × 21 cm), Paper: Lined White 70# Uncoated Text
Zazzle Reviewer Program
I am very satisfied with this guestbook. The cover is smooth and varnished, it looks like its a good qyality. The guestbook is rigid and the customization was done exactly as I requested. I'm very happy about this. Very good. No problem of printing and i love the cover's finish.
5 out of 5 stars rating
By Suzanne M.30 September 2021Verified Purchase
Size: 10.5" x 8.25" (26.7 cm × 21 cm), Paper: Lined White 70# Uncoated Text
Zazzle Reviewer Program
A beautifully presented guest book which came with a lovely gift box for storage. The book was hard back so stayed fresh after being handed around to all our wedding guests. We had lots of compliments about the design which went perfectly with our theme. Perfect, no issues at all with the printing. It arrived on time and came well packaged.

Tags

Guest Books
dolphinsoceanguest bookfishturtleswavesislandswildlifeanimalsaquatic
All Products
dolphinsoceanguest bookfishturtleswavesislandswildlifeanimalsaquatic

Other Info

Product ID: 256594565573721818
Created on 16/02/2019, 1:05
Rating: G