Tap / click on image to see more RealViewsTM
£7.95
per sheet of 20
 

Broken Down Car Wreck Automobile Clipart Square Sticker

Qty:
Square Stickers
+£0.35
+£0.35
+£0.35

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Broken Down Car Wreck Automobile Clipart Square Sticker

Broken Down Car Wreck Automobile Clipart Square Sticker

A simple, flat black illustration of a broken down and wrecked motor vehicle ready for the scrap heap.

Customer Reviews

4.8 out of 5 stars rating26.8K Total Reviews
23270 total 5-star reviews2212 total 4-star reviews524 total 3-star reviews299 total 2-star reviews451 total 1-star reviews
26,756 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous8 September 2025Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Tim S.23 October 2017Verified Purchase
Zazzle Reviewer Program
Brilliant quality stickers perfect for Branding my business products. Perfect printing, excellent quality paper and finish.

Tags

Stickers
motorvehicleaccidentmechanicscrapsafetyroadcollisionbreakdowncrash
All Products
motorvehicleaccidentmechanicscrapsafetyroadcollisionbreakdowncrash

Other Info

Product ID: 256011046397593598
Created on 22/07/2023, 3:08
Rating: G