Tap / click on image to see more RealViewsTM
Sale Price £2.70.  
Original Price £3.60 per card
You save 25%

Caduceus

Qty:
Squared
Basic Semi-Gloss
16 pt thickness / 150 lb weight Bright white, smooth texture

About Flat Cards

Sold by

Size: 10.2 cm x 22.9 cm

Stand out with custom flat cards, turn this flat card into anything imaginable.

  • Dimensions: 10.2 cm x 22.9 cm (portrait or landscape)
  • High-quality, full-colour, full-bleed printing
  • Print on both sides for no additional cost
  • Add personal photos and text for free

Paper Type: Basic Semi-Gloss

Bright, smooth, and polished—our Basic Semi-Gloss paper brings your design to life with vibrant colour and a subtle shine. It’s the perfect choice for everyday elegance and budget-friendly celebrations.

About This Design

Caduceus

Caduceus

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating2.5K Total Reviews
2137 total 5-star reviews159 total 4-star reviews43 total 3-star reviews29 total 2-star reviews84 total 1-star reviews
2,452 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous17 March 2022Verified Purchase
Flat Card, Size: 10.2 cm x 22.9 cm, Paper: Basic Semi-Gloss, Corner: Squared
Zazzle Reviewer Program
Amazing product, Gift cards look really professional and quality wouldn’t disappoint anyone. I am very satisfied with my order. Great printing, looks really amazing professional and really worth for anyone to get on any occasion
5.0 out of 5 stars rating
5 out of 5 stars rating
By Nelly W.7 August 2021Verified Purchase
Flat Card, Size: 20.3 cm x 10.2 cm, Paper: Basic Semi-Gloss, Corner: Squared
Zazzle Reviewer Program
I am staring my own business and I’ve decided to go with this design. I didn’t expect it to come out soo well but this product is 10% more than what I expected. Perfect size and thigh card too. It also comes with envelopes which I didn’t expect, but it’s very helpful. The quality is absolutely perfect, the image came out exactly how I wanted it to. My customers lovee the look of it.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Debra S.7 February 2017Verified Purchase
Flat Card, Size: 16.5 cm x 22.2 cm, Paper: Signature Matte, Corner: Squared
Zazzle Reviewer Program
Beautiful, quality product, order numerous items for baby shower and all of exepctions quality, good delivery. Excellent range and choice, easy to personalise. Brilliant website/company, highly recommended. Excellent quality and finish. Extremely pretty, perfect.

Tags

Flat Cards
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 245343749875724602
Created on 25/04/2010, 13:54
Rating: G