Tap / click on image to see more RealViewsTM
Sale Price £14.84.  
Original Price £18.55 per pack of 50
You save 20%

Caduceus Business Card

Qty:
  1. Size

  2. Corner Style

  3. Paper

Other designs from this category

About Business Cards

Sold by

Size: 89 mm x 51 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 89 mm × 51 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust colour and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection

About This Design

Caduceus Business Card

Caduceus Business Card

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating41.6K Total Reviews
34319 total 5-star reviews3980 total 4-star reviews1137 total 3-star reviews774 total 2-star reviews1393 total 1-star reviews
41,603 Reviews
5.0 out of 5 stars rating
5 out of 5 stars rating
By name7 April 2015 • Verified Purchase
Business Card, Size: 89 mm x 51 mm,Paper: Signature UV Matte, Corners: Squared
Zazzle Reviewer Program
Gold Business Cards Stand Out !!! Easy to locate among the others. printing is great!!!!
from zazzle.com (US)
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By keeley l.25 March 2024 • Verified Purchase
Business Card, Size: 89 mm x 64 mm,Paper: Standard Semi-Gloss, Corners: Squared
I absolutely love ordering cards for my jewellery business from Zazzle. I especially love the earring cards as they have the holes pre marked ready for me to punch and apply my earrings. I’m now looking to get the round stickers with my business name and logo on. Amazing service. Printing was perfect exactly what I was looking for.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tina B.3 January 2021 • Verified Purchase
Business Card, Size: 85 mm x 55 mm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
The Zazzle business card design tool was excellent, easy to use and offering plenty of options. I wanted a card ln portrait with space to display my jewellery and my logo. The basic Zazzle cards are great quality and sturdy enough to take a necklace and earrings without buckling. A little pricey, but worth it to have my own design, as I wanted it. Thank you Zazzle. My image contains extremely fine script and delicate colouring. Zazzle reproduced these precisely and without any fuzz or blur. Colour was as expected, even though it was hard to choose sometimes as monitors vary.

Tags

caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 240912045309499135
Created on 25/04/2010, 13:11
Rating: G