Tap / click on image to see more RealViewsTM
Sale Price £23.89.  
Original Price £31.85 per pack of 100
You save 25% ends today

Caduceus Business Card

Qty:
Squared
+£6.15
Signature UV Matte

18 pt thickness / 325 GSM
Bright white, matte finish

-£6.15
-£6.15
+£6.10
+£6.10
+£6.10
+£6.10
+£6.10
+£6.10
+£17.10

Other designs from this category

About Business Cards

Sold by

Size: American, 89 mm x 51 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 89 mm x 51 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust colour and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection

About This Design

Caduceus Business Card

Caduceus Business Card

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating39K Total Reviews
32733 total 5-star reviews3870 total 4-star reviews965 total 3-star reviews583 total 2-star reviews890 total 1-star reviews
39,041 Reviews
5 out of 5 stars rating
By n.7 April 2015Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Signature UV Matte, Corners: Squared
Zazzle Reviewer Program
Gold Business Cards Stand Out !!! Easy to locate among the others. printing is great!!!!
from zazzle.com (US)
Reviews for similar products
5 out of 5 stars rating
By keeley l.25 March 2024Verified Purchase
Business Card, Size: Mighty, 89 mm x 64 mm,Paper: Standard Semi-Gloss, Corners: Squared
I absolutely love ordering cards for my jewellery business from Zazzle. I especially love the earring cards as they have the holes pre marked ready for me to punch and apply my earrings. I’m now looking to get the round stickers with my business name and logo on. Amazing service. Printing was perfect exactly what I was looking for.
5 out of 5 stars rating
By Marta W.15 February 2022Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle Reviewer Program
The product it’s great, great graphics and colours, I loved that I could made this card on my own way, just like I wanted. The cards came out fabulous I love it so much.

Tags

Business Cards
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 240912045309499135
Created on 25/04/2010, 13:11
Rating: G