Tap / click on image to see more RealViewsTM
£10.60
per sheet of 20
 

Caduceus Classic Round Sticker

Qty:
Classic Round Stickers
+£0.40
+£0.40
+£0.40

Other designs from this category

About Stickers

Sold by

Shape: Classic Round Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Caduceus Classic Round Sticker

Caduceus Classic Round Sticker

Design that makes caduceus motif

Customer Reviews

4.8 out of 5 stars rating27.2K Total Reviews
23581 total 5-star reviews2228 total 4-star reviews565 total 3-star reviews346 total 2-star reviews518 total 1-star reviews
27,238 Reviews
Reviews for similar products
5 out of 5 stars rating
By Natalie H.14 December 2021Verified Purchase
Zazzle Reviewer Program
I’m very happy with my stickers they are perfect for labelling my candles. Customer service and the prices have always been spot on. I would highly recommend. I love the colour and wording on my stickers
5 out of 5 stars rating
By Sally M.6 April 2022Verified Purchase
Zazzle Reviewer Program
I was really pleased with the stickers and the design, they are exactly what I was looking for. Delivered on time and good value. Colours look great and printing good quality.
5 out of 5 stars rating
By Rebecca B.27 February 2024Verified Purchase
Zazzle Reviewer Program
Such great quality stickers for my candles Perfect size, very happy with these ⭐️⭐️⭐️⭐️⭐️. Excellent printing quality and colour

Tags

Stickers
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 217176518511647409
Created on 26/04/2010, 7:47
Rating: G