Tap / click on image to see more RealViewsTM
£23.80
per poster
 

Caduceus Poster

Qty:
Choose Your Format
Custom (43.31cm x 50.75cm)
None

Other designs from this category

About Posters

Sold by

Paper Type: Value Poster Paper (Semi-Gloss)

Your walls are a reflection of your personality, so let them speak with your favourite quotes, art, or designs printed on our custom Giclée posters! High-quality, microporous resin-coated paper with a beautiful semi-gloss finish. Choose from standard or custom-sized posters and framing options to create art that’s a perfect representation of you.

  • Gallery-quality Giclée prints
  • Ideal for vibrant artwork and photographic reproduction
  • Semi-gloss finish
  • Pigment-based inks for full-colour spectrum high-resolution printing
  • Durable 185gsm paper
  • Available in custom sizing up to 152.4 cm
  • Frames available on all standard sizes
  • Frames include Non-Glare Acrylic Glazing

About This Design

Caduceus Poster

Caduceus Poster

Design that makes caduceus motif

Customer Reviews

4.8 out of 5 stars rating14.5K Total Reviews
12480 total 5-star reviews1366 total 4-star reviews249 total 3-star reviews146 total 2-star reviews265 total 1-star reviews
14,506 Reviews
Reviews for similar products
5 out of 5 stars rating
By S.17 January 2013Verified Purchase
Print, Size: 58.42cm x 67.37cm, Media: Value Poster Paper (Semi-Gloss)
Zazzle Reviewer Program
I like the design features on the website. They enable the fitting of a good quality Print to an existing frame. This Print was of excellent quality. I would buy again. One small gripe is that the image was not centred horizontally (about 3mm out) so needed trimming. No great hardship and may have been my fault in the setting-up. Next time, I would choose to set the text below the picture to a smaller font. Overall - Thank You! Looks good in its frame - Just as expected. I had a very expensive Gallery print of this before. It got damaged - hence the replacement. It compares very well.
5 out of 5 stars rating
By A.26 April 2018Verified Purchase
Print, Size: 33.02cm x 48.26cm, Media: Value Poster Paper (Semi-Gloss)
Zazzle Reviewer Program
Would highly recommend as very helpful. Prints...just perfect 😀
5 out of 5 stars rating
By A N.8 January 2022Verified Purchase
Print, Size: 50.80cm x 40.64cm, Media: Value Poster Paper (Semi-Gloss)
Zazzle Reviewer Program
Zazzle's pictures are Amazing - I can't find these Products in the type of papers I need anywhere else. They cut them to the exact size you need , often changing the proportions to your exact requirement, The Customer Support are second to none , helpful, friendly and polite . Incredible Company - The prices are Great and so much to choose from. The Prints are clear and well Defined.

Tags

Posters
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 228598453171099113
Created on 25/04/2010, 13:20
Rating: G