Tap / click on image to see more RealViewsTM
Sale Price £33.26.  
Original Price £36.95 per tie
You save 10%

Caduceus Tie

Qty:

    Other designs from this category

    About Ties

    Sold by

    Style: Tie

    Upgrade your wardrobe a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

    • Dimensions:
      • Length: 139 cm (55")
      • Width: 10.16 cm (4") (at widest point)
    • Printed in vibrant full colour
    • Made from 100% polyester; silky finish
    • Double-sided printing available at small up-charge. Check out the "Design Area" tab to the right to customise
    • Dry clean only

    About This Design

    Caduceus Tie

    Caduceus Tie

    Design that makes caduceus motif

    Customer Reviews

    4.5 out of 5 stars rating2.6K Total Reviews
    1934 total 5-star reviews337 total 4-star reviews147 total 3-star reviews79 total 2-star reviews138 total 1-star reviews
    2,635 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Anonymous5 August 2025 • Verified Purchase
    Tie
    Very happy with 1) quality of the print 2) quality & cut of the tie 3) speed of manufacturing 4) communication & 5) delivery to UK. I discovered the product just 2 weeks before a wedding so had to use the express delivery but it arrived within days so I could relax. My first experience of this seller & Zazzle and both were great .
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Mental M.29 March 2022 • Verified Purchase
    Tie
    Zazzle Reviewer Program
    I wasn't sure what to expect but was excited to have a tie for my husband which matched my wedding attire. A super easy process taking a photo of my dress and uploading it to the website. I waited in anticipation not knowing how it would turn out. I couldn't believe the quality, its excellent. The print, pattern and colour is strong and vibrant. I have uploaded a photo but its difficult to see the tie against the dress because the quality is exceptional. I would have no hesitation using this company again.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By E.15 May 2022 • Verified Purchase
    Tie
    Zazzle Reviewer Program
    I purchased this tie as my son one in the family tartan I saw this when I googled it You design it yourself they produce it I was very happy and surprised as the quality and the tie. The printing was excellent would recommend

    Tags

    caduceusmedicalsymbolmedicinegreekphysicianswandhermes

    Other Info

    Product ID: 151268738381438883
    Created on 25/04/2010, 13:10
    Rating: G