Tap / click on image to see more RealViewsTM
£30.55
per tie
 

Caduceus Tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 139 cm (55")
    • Width: 10.16 cm (4") (at widest point)
  • Printed in vibrant full colour
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small up-charge. Check out the "Design Area" tab to the right to customise
  • Dry clean only

About This Design

Caduceus Tie

Caduceus Tie

Design that makes caduceus motif

Customer Reviews

4.5 out of 5 stars rating2.5K Total Reviews
1889 total 5-star reviews334 total 4-star reviews136 total 3-star reviews71 total 2-star reviews111 total 1-star reviews
2,541 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous5 August 2025Verified Purchase
Tie
Very happy with 1) quality of the print 2) quality & cut of the tie 3) speed of manufacturing 4) communication & 5) delivery to UK. I discovered the product just 2 weeks before a wedding so had to use the express delivery but it arrived within days so I could relax. My first experience of this seller & Zazzle and both were great .
5 out of 5 stars rating
By Mental M.29 March 2022Verified Purchase
Tie
Zazzle Reviewer Program
I wasn't sure what to expect but was excited to have a tie for my husband which matched my wedding attire. A super easy process taking a photo of my dress and uploading it to the website. I waited in anticipation not knowing how it would turn out. I couldn't believe the quality, its excellent. The print, pattern and colour is strong and vibrant. I have uploaded a photo but its difficult to see the tie against the dress because the quality is exceptional. I would have no hesitation using this company again.
5 out of 5 stars rating
By E.15 May 2022Verified Purchase
Tie
Zazzle Reviewer Program
I purchased this tie as my son one in the family tartan I saw this when I googled it You design it yourself they produce it I was very happy and surprised as the quality and the tie. The printing was excellent would recommend

Tags

Ties
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 151268738381438883
Created on 25/04/2010, 13:10
Rating: G