Tap / click on image to see more RealViewsTM
£20.70
per mug
 

Caduceus Travel Mug

Qty:
Travel/Commuter Mug
-£4.15
-£3.20
-£2.30
+£0.40
Stainless Steel

Other designs from this category

About Mugs

Sold by

Style: Travel/Commuter Mug

You don’t have to give up a colourful, funny, or attractive design for the function of a top-notch travel mug. Zazzle’s commuter mugs feature a rubber-lined lid for a tight, spill-resistant seal — twist the lid to reveal the sip opening! So, take your favourite photo, monogram, pattern, or cool design with you on your new favourite mug.

  • Dimensions: 414 ml (14-ounce): 6.4 cm diameter base x 8.9 cm diameter x 15.7 cm height (2.5” D base x 3.5” D x 6.2” H)
  • Materials: Stainless steel body; plastic handle and base; rubber-lined plastic lid
  • Double-walled stainless steel helps keep your drink of choice hot
  • Do not microwave; hand wash recommended
  • Printed on demand in San Jose, California
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Caduceus Travel Mug

Caduceus Travel Mug

Design that makes caduceus motif

Customer Reviews

4.8 out of 5 stars rating22.6K Total Reviews
19903 total 5-star reviews1898 total 4-star reviews360 total 3-star reviews159 total 2-star reviews253 total 1-star reviews
22,573 Reviews
Reviews for similar products
5 out of 5 stars rating
By Chris B.9 June 2018Verified Purchase
Travel/Commuter Mug, 444 ml
Zazzle Reviewer Program
The final product far exceeded my expectations when it arrived. It feels solid, looks impressive, and I love the style. It has a very solid lid which is still easy to remove and re fit. Looks great in the Stainless Steel and it was delivered on time and very well packaged. I have only one little niggle, and that is the logo background colour of black doesn't quite match the black that they company uses so you can see the slight difference is tones. It would have been great if these matched and to be honest, I am not sure if that is something I would have to do my end before uploading or if this could be sorted at the printing stage.
5 out of 5 stars rating
By Anonymous4 April 2026Verified Purchase
Travel/Commuter Mug, 444 ml
Arrived quickly, perfect! .
5 out of 5 stars rating
By Nancy L.11 November 2020Verified Purchase
Travel/Commuter Mug, 444 ml
Zazzle Reviewer Program
It's the perfect size for a travel mug. A very good item and I know my son will love it. I'm delighted with how the photos and lettering came out on this item. I managed to get x4 photos on it rather than the usual one. I'm very pleased with this item.

Tags

Mugs
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 168682776586601869
Created on 25/04/2010, 13:17
Rating: G