Tap / click on image to see more RealViewsTM
£9.05
per sheet of 20
 

Cat Bride and Groom Wedding Day Square Sticker

Qty:
Square Stickers
+£0.40
+£0.40
+£0.40

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Cat Bride and Groom Wedding Day Square Sticker

Cat Bride and Groom Wedding Day Square Sticker

Vintage image of Bride and Groom cats complete with bouquet, veil and top hat. A sweet vintage image to share.

Customer Reviews

4.8 out of 5 stars rating4.2K Total Reviews
3577 total 5-star reviews394 total 4-star reviews97 total 3-star reviews48 total 2-star reviews66 total 1-star reviews
4,182 Reviews
Reviews for similar products
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Anonymous1 April 2026Verified Purchase
Simple yet perfect addition that finished off our wedding invites .
5 out of 5 stars rating
By Elaine P.15 July 2023Verified Purchase
Zazzle Reviewer Program
Easy to order. Good size. Print quality brilliant. Will use to label my crafting boxes so that they are easily identifiable when borrowed! Easy to design. Great choice. Quality exceptional. Thoroughly recommend

Tags

Stickers
weddingcatbridegroomvintagekeepsakewedmarriageceremonydate
All Products
weddingcatbridegroomvintagekeepsakewedmarriageceremonydate

Other Info

Product ID: 256554322518818909
Created on 17/07/2025, 20:55
Rating: G