Tap / click on image to see more RealViewsTM
£30.55
per roll
 

Charming Blush Pink Sweet Candy Cane Gift Wrapping Paper

Qty:

Other designs from this category

About Wrapping Paper

Sold by

Paper Finish: Matte

Make sure every gift you give has a layer of love by creating custom wrapping paper. Available in four types of premium paper and five different sizes, our wrapping paper covers all your gift wrapping needs - because presentation matters as much as the gift!

  • 64lb print quality matte paper
  • Ideal for printing photos
  • Full colour edge-to-edge printing
  • Width: 74 cm
  • Length: multiple options from 1.8 m to 18.3 m
  • Each roll up to 4.6 m in length; lengths greater than 4.6 m shipped as multiple 4.6 m rolls
  • Length guide:
    • 1.8 m roll wraps 3 shirt-sized boxes
    • 4.6 m roll wraps 9 shirt-sized boxes
    • 9.1 m roll wraps 18 shirt-sized boxes
    • 13.7 m roll wraps 27 shirt-sized boxes
    • 18.3 m roll wraps 36 shirt-sized boxes
  • Designable area is 91 x 76 cm, but scaled down uniformly and printed at 88.4 x 73.7 cm
  • Please note: Designs are tiled after first 88.4 x 73.7 cm printed section

About This Design

Charming Blush Pink Sweet Candy Cane Gift  Wrapping Paper

Charming Blush Pink Sweet Candy Cane Gift Wrapping Paper

Wrap your gifts in the essence of holiday sweetness with our Charming Blush Pink Sweet Candy Cane Gift Wrap. Designed with a girlish charm, this wrapping paper features an adorable candy cane motif set against a delicate blush pink background, perfect for adding a dash of whimsy to your present presentation. The soft pink hues blend with the classic candy cane design to create a cute and inviting package, ideal for the holiday season. Whether it's for Christmas morning or a special winter celebration, this paper is sure to make your gifts stand out under the tree, delighting recipients of all ages with its delightful and playful pattern.

Customer Reviews

4.7 out of 5 stars rating4.2K Total Reviews
3490 total 5-star reviews382 total 4-star reviews116 total 3-star reviews77 total 2-star reviews117 total 1-star reviews
4,182 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jan T.18 August 2025Verified Purchase
Wrapping Paper, Matte
I love this paper and it was large enough to put on the back of a glazed cabinet. It’s had lots of comments. I painted the interior to extend the image and it was very pleased with the result.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Julia M.24 May 2017Verified Purchase
Zazzle Reviewer Program
I really liked this product, the picture is lovely and the colours are really nice. I wanted it to up-cycle a writing bureau and I was concerned that the paper may be too thin. But it wasn't and it worked fine. On the pictures I have uploaded the print looks a bit aged and not so vivid and new looking. As I wanted an aged patina but the actual print is clearer and the colours are brighter. The colour and prints are good.
Original product
5.0 out of 5 stars rating
5 out of 5 stars rating
By B.20 October 2017Verified Purchase
Wrapping Paper, Matte
Zazzle Reviewer Program
Very strong quality paper used. I used it to cover a lampshade, and it looks stunning now. Vibrant and vivid. Such lovely colours.

Tags

Wrapping Paper
All Products
christmas wrapping papercandy canecutesimpleblush pinkgirlypinkpatternsweetfeminine

Other Info

Product ID: 256647581624454889
Created on 09/12/2023, 6:11
Rating: G