Tap / click on image to see more RealViewsTM
£10.00
per sheet of 6
 

Charming Sakura in Lavender Sticker

4.8 out of 5 stars rating
27395 Total Reviews
|
by
Qty:
Square Stickers
+£0.35
+£0.35
+£0.35

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Charming Sakura in Lavender Sticker

Charming Sakura in Lavender Sticker

This lavender sticker features a white cherry blossom, accenting text that can be customised for your special spring-themed event. These stickers are perfect for decorating gift bags at weddings or party favours for any special event or for use as save-the-date stickers that your invited guests can put in their keepsake collections. Be sure to check out the other products in the Charming Sakura in Lavender set to create a truly coordinated look for your event.

Customer Reviews

4.8 out of 5 stars rating27.4K Total Reviews
23689 total 5-star reviews2235 total 4-star reviews573 total 3-star reviews363 total 2-star reviews535 total 1-star reviews
27,395 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous8 September 2025Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tim S.23 October 2017Verified Purchase
Zazzle Reviewer Program
Brilliant quality stickers perfect for Branding my business products. Perfect printing, excellent quality paper and finish.

Tags

Stickers
valeriedesign valerie hartley bennettlayers of designspringsakuracherry blossomflowerlavenderlilacamethystpastel purple
All Products
valeriedesign valerie hartley bennettlayers of designspringsakuracherry blossomflowerlavenderlilacamethystpastel purple

Other Info

Product ID: 217020178215752892
Created on 23/01/2014, 7:36
Rating: G