Tap / click on image to see more RealViewsTM
£18.00
per pack of 50
 

Cherries Business Cards

Qty:
Squared
+£6.00
Signature UV Matte

18 pt thickness / 325 GSM
Bright white, matte finish

-£5.05
-£5.05
+£4.95
+£4.95
+£4.95
+£4.95
+£4.95
+£4.95
+£13.85

Other designs from this category

About Business Cards

Sold by

Size: American, 89 mm x 51 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 89 mm x 51 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust colour and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection

About This Design

Cherries Business Cards

Cherries Business Cards

designed by marlodeedesigns.com © 2004-2012 MarloDee Designs: All rights reserved. All necessary licenses have been purchased and are on file. Images on this site are NOT public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing. You may NOT use them to decorate your website with or create additional products for your business. You MUST contact me for details, information or requests to use images on your business cards. Purchasing business cards here does not give you automatic permissiion to use the image on other items - nor - does it give you exclusive rights or usage rights.

Customer Reviews

4.7 out of 5 stars rating40.2K Total Reviews
33410 total 5-star reviews3913 total 4-star reviews1053 total 3-star reviews679 total 2-star reviews1095 total 1-star reviews
40,150 Reviews
Reviews for similar products
5 out of 5 stars rating
By keeley l.25 March 2024Verified Purchase
Business Card, Size: Mighty, 89 mm x 64 mm,Paper: Standard Semi-Gloss, Corners: Squared
I absolutely love ordering cards for my jewellery business from Zazzle. I especially love the earring cards as they have the holes pre marked ready for me to punch and apply my earrings. I’m now looking to get the round stickers with my business name and logo on. Amazing service. Printing was perfect exactly what I was looking for.
5 out of 5 stars rating
By Tina B.3 January 2021Verified Purchase
Business Card, Size: UK / Euro, 85 mm x 55 mm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
The Zazzle business card design tool was excellent, easy to use and offering plenty of options. I wanted a card ln portrait with space to display my jewellery and my logo. The basic Zazzle cards are great quality and sturdy enough to take a necklace and earrings without buckling. A little pricey, but worth it to have my own design, as I wanted it. Thank you Zazzle. My image contains extremely fine script and delicate colouring. Zazzle reproduced these precisely and without any fuzz or blur. Colour was as expected, even though it was hard to choose sometimes as monitors vary.
5 out of 5 stars rating
By Marta W.15 February 2022Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle Reviewer Program
The product it’s great, great graphics and colours, I loved that I could made this card on my own way, just like I wanted. The cards came out fabulous I love it so much.

Tags

Business Cards
cherrycherriesfruitfoodcookingkitchenwhimiscalprettychicbusiness
All Products
cherrycherriesfruitfoodcookingkitchenwhimiscalprettychicbusiness

Other Info

Product ID: 240439096599212623
Created on 24/03/2008, 17:47
Rating: G