Tap / click on image to see more RealViewsTM
£24.00
per shirt
 

Cherry Hearts T-Shirt

Qty:
  1. Size

  2. Style

  3. Colour & Print Process: White

    Classic Printing: No Underbase
    Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft – a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customise it and unleash your creativity!

Size & Fit

  • Model is 5'7"/170 cm and is wearing a Small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Tagless label for comfort
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Cherry Hearts T-Shirt

Cherry Hearts T-Shirt

Sweet, playful, and full of charm, this Cherry Hearts T‑shirt brings a fresh twist to classic Valentine style. Featuring a cute cherry motif paired with heart‑shaped accents, it’s perfect for anyone who loves fun, flirty designs with a touch of retro sweetness. Whether you’re dressing for Valentine’s Day, gifting someone special, or simply adding a little love‑themed flair to your everyday wardrobe, this tee delivers cheerful vibes and effortless style.

Customer Reviews

4.5 out of 5 stars rating15.3K Total Reviews
10860 total 5-star reviews2936 total 4-star reviews849 total 3-star reviews406 total 2-star reviews272 total 1-star reviews
15,323 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tanya R.11 September 2022Verified Purchase
Basic T-Shirt, White, Large
Zazzle Reviewer Program
When my teeshirt arrived I was delighted. The material is very good quality and it fitted me PERFECT. I think ZAZZLE is much better than other companies who sell teeshirts. I highly recommend anyone to shop here! THANKU ZAZZLE! 😀😁🙌. Printing on my teeshirt was perfect.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Grace S.5 July 2020Verified Purchase
V-Neck T-Shirt, White, Small
Creator Review
I designed this shirt and I’m so happy with the print. I bought it in the cheaper shirt available and I bought it 2 sizes bigger because it runs small. It was perfect to wear to church today! It printed out beautifully! I’m so impressed with the quality!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Pollyanna P.26 August 2019Verified Purchase
Basic T-Shirt, Black, Large
Zazzle Reviewer Program
I was so happy with how it came out and the personalisation, thank you so much! Such a great product!! Great! It was true to the online example and the quality was perfect :)

Tags

All Products
cherryheartfunkycutesweetvalentinegraphicflirtycherries

Other Info

Product ID: 256124709515819054
Created on 06/02/2026, 12:27
Rating: G