Tap / click on image to see more RealViewsTM
£18.80
£2.35 per paper plate
 

Christmas Open House Paper Plates 9"

Qty:
Personalise this template
22.9 cm Round Paper Plate
-£0.35
-£0.40
-£0.70

Other designs from this category

About Paper Plates

Sold by

Size and Style: 22.9 cm Round Paper Plate

Throw a spectacular party with fully customisable paper plates to match your theme! Each set of paper plates is printed on durable paper stock and decorated with your custom designs or photos. These plates are perfect for serving dinner, appetizers, or salads. Order these with our paper napkins for a complete set of party tableware that your guests will love!

  • Dimensions: 22.8 cm diameter (9" diameter)
  • FDA compliant for food contact safety
  • Great for serving dinners, lunches, appetizers, or salads
  • Printed in USA

About This Design

Christmas Open House Paper Plates 9"

Christmas Open House Paper Plates 9"

Welcome, guests to your holiday home with a custom made a paper plate. Personalise this plate with your own words.***This graphic design was created from public domain illustrations that were layered onto the plate.

Customer Reviews

4.6 out of 5 stars rating1.3K Total Reviews
1068 total 5-star reviews101 total 4-star reviews40 total 3-star reviews38 total 2-star reviews56 total 1-star reviews
1,303 Reviews
Reviews for similar products
5 out of 5 stars rating
By Alegria D.3 January 2023Verified Purchase
Paper Plates, 22.9 cm Round Paper Plate
Zazzle Reviewer Program
Absolutely love them! Arrived before than expected and it’s like the preview. Perfect. It’s exactly as the preview.
5 out of 5 stars rating
By P.20 March 2018Verified Purchase
Paper Plates, 17.8 cm Round Paper Plate
Zazzle Reviewer Program
Perfect great for 1st birthday. Well worth money was just what u was after
4 out of 5 stars rating
By M.4 October 2023Verified Purchase
Paper Plates, 22.9 cm Round Paper Plate
Zazzle Reviewer Program
I ordered these for my 14 year old daughters "Murder Mystery" birthday party and she loved them. A great product that I ordered from the USA to England. However LUCKILY they arrived undamaged. They were in a flimsy bag which meant they were not protected from being crushed or bent. I could easily have bent the package in half which would have made them unusable. A simple cardboard box would have been ensured they were protected from travelling so far. Excellent quality and perfect for the party

Tags

Paper Plates
holiday partyopen housesnowmanfamilyfriendschristmaspaper plate
All Products
holiday partyopen housesnowmanfamilyfriendschristmaspaper plate

Other Info

Product ID: 256495157307116895
Created on 20/06/2017, 20:51
Rating: G