Tap / click on image to see more RealViewsTM
£33.15
per All-Over Print Apron
 

Classic Plaid Tartan Pattern-Navy & White Apron

Qty:
Black
Medium
-£4.30
+£2.90

Other designs from this category

About All-Over Print Aprons

Sold by

Size: All-Over Print Apron, Medium 66.04 cm x 76.2 cm (26"x30")

Whether you are cooking at home, hosting a summer BBQ, or creating arts & crafts- do so in style with our fully customisable aprons! Made of a top quality polyester, our fully sublimation designs will definitely make a great impression on your guests. Available in 3 sizes for adults, young adults, children- basically everyone! Each size is adorned with a sublimated neck strap and adjustable waist string to ensure the best design results.

  • Dimensions: 76.2 cm (30") length x 66.04 cm (26") width
  • Waist String 87.63 cm (34.5")
  • Material: 100% Polyester
  • Full Dye Sublimation
  • One Side Printing Available
  • Machine wash in cold water on gentle cycle with mild detergent. Do not bleach or iron. Line dry.

About This Design

Classic Plaid Tartan Pattern-Navy & White Apron

Classic Plaid Tartan Pattern-Navy & White Apron

This apron features a classic plaid tartan pattern with crisp, intersecting lines and perfectly balanced symmetry. The structured check design blends heritage charm with modern versatility, making it a stylish and functional choice for cooking, baking, crafting, or hosting. Its repeating grid motif adapts beautifully to any colour palette — from understated neutrals to bold, high‑contrast combinations — ensuring it complements a wide range of personal styles and kitchen décor

Customer Reviews

4.7 out of 5 stars rating661 Total Reviews
577 total 5-star reviews42 total 4-star reviews5 total 3-star reviews8 total 2-star reviews29 total 1-star reviews
661 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Isobel B.13 September 2022Verified Purchase
All-Over Print Apron, Medium
Zazzle Reviewer Program
I have to say, although I've not started my little business yet, when I created the design for this apron, I never expected the quality of the print or the lovely material used to make it to be as fantastic as it is. Total perfect. The clarity is amazing.
5.0 out of 5 stars rating
5 out of 5 stars rating
By W.26 March 2022Verified Purchase
All-Over Print Apron, Medium
Zazzle Reviewer Program
They are high quality , we bought five for all stuff members. It is very light so it doesn't bother you at all while working unlike other aprons. Very very satisfied. Printing is excellent.
5.0 out of 5 stars rating
5 out of 5 stars rating
By S.16 May 2024Verified Purchase
All-Over Print Apron, Medium
It was above my expectations, high quality fabric and great printing! Great printing quality.

Tags

All-Over Print Aprons
classicplaidaprontartanpatternaprongeometriccheckaprontimelessplaidhomedecormoderntraditionalapronstructuredgridpatternversatilepatternapronstatementplaidapronsymmetricalcheckdesignnavywhiteplaidapron
All Products
classicplaidaprontartanpatternaprongeometriccheckaprontimelessplaidhomedecormoderntraditionalapronstructuredgridpatternversatilepatternapronstatementplaidapronsymmetricalcheckdesignnavywhiteplaidapron

Other Info

Product ID: 256443526394758011
Created on 12/09/2025, 17:24
Rating: G