Tap / click on image to see more RealViewsTM
Sale Price £18.34.  
Original Price £24.45 per pack of 100
You save 25%

Farmers Market Organic Fresh Eggs Chicken Business Card

Qty:
Squared
+£6.15
Signature Matte

17.5 pt thickness / 324 GSM weight
Light eggshell white, uncoated matte finish

+£5.85
+£5.85
+£5.85
+£11.70
+£11.70
+£11.70
+£11.70
+£11.70
+£11.70
+£22.15

Other designs from this category

Shop this collection

Dhouha Zarria
Fresh Eggs Collection Designed by Dhouha Zarria
Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Business Cards

Sold by

Size: American, 89 mm x 51 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 89 mm x 51 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature Matte

A classic, all around paper with a natural feel and an uncoated matte finish; our Standard Matte stands the test of time. Elegant and understated, colours print softer and more subtle.

  • 17.5 pt thickness / 324 GSM weight
  • Light white, uncoated matte finish with an eggshell texture
  • Paper is easy to write on and won't smudge

About This Design

Farmers Market Organic Fresh Eggs Chicken  Business Card

Farmers Market Organic Fresh Eggs Chicken Business Card

Make a lasting impression with this clean and professional business card. Perfect for your farmers market stall, it highlights the quality and freshness of your organic eggs. Featuring a sleek design with a charming chicken motif, it’s an excellent way to promote your farm business and connect with customers.

Customer Reviews

4.7 out of 5 stars rating39.6K Total Reviews
33085 total 5-star reviews3888 total 4-star reviews1007 total 3-star reviews628 total 2-star reviews997 total 1-star reviews
39,605 Reviews
Reviews for similar products
5 out of 5 stars rating
By keeley l.25 March 2024Verified Purchase
Business Card, Size: Mighty, 89 mm x 64 mm,Paper: Standard Semi-Gloss, Corners: Squared
I absolutely love ordering cards for my jewellery business from Zazzle. I especially love the earring cards as they have the holes pre marked ready for me to punch and apply my earrings. I’m now looking to get the round stickers with my business name and logo on. Amazing service. Printing was perfect exactly what I was looking for.
5 out of 5 stars rating
By Marta W.15 February 2022Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle Reviewer Program
The product it’s great, great graphics and colours, I loved that I could made this card on my own way, just like I wanted. The cards came out fabulous I love it so much.
5 out of 5 stars rating
By Tina B.3 January 2021Verified Purchase
Business Card, Size: UK / Euro, 85 mm x 55 mm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
The Zazzle business card design tool was excellent, easy to use and offering plenty of options. I wanted a card ln portrait with space to display my jewellery and my logo. The basic Zazzle cards are great quality and sturdy enough to take a necklace and earrings without buckling. A little pricey, but worth it to have my own design, as I wanted it. Thank you Zazzle. My image contains extremely fine script and delicate colouring. Zazzle reproduced these precisely and without any fuzz or blur. Colour was as expected, even though it was hard to choose sometimes as monitors vary.

Tags

Business Cards
farmers marketrusticcountryfarmhousechickenfarmvintagechickensfamily farmegg business cards
All Products
farmers marketrusticcountryfarmhousechickenfarmvintagechickensfamily farmegg business cards

Other Info

Product ID: 256877951835633484
Created on 21/06/2024, 13:10
Rating: G