Tap / click on image to see more RealViewsTM
Sale Price £1.78.  
Original Price £2.37 per card
You save 25%

Custom Enchanted Daisy Baby Shower Thank You Card

Collection
Qty:
Squared
+£0.20
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+£0.64
+£0.64
-£0.16

Other designs from this category

Shop this collection

Dylan Ashlay Ramjee
Magical Cute Daisy Baby ShowerDesigned by Dylan Ashlay Ramjee
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

About Flat Thank You Cards

Sold by

Size: 8.9 cm x 12.7 cm

For all the ways you say thank you, we've got a custom thank you card just for you.

  • Dimensions: 8.9 cm L x 12.7 cm H (portrait); 12.7 cm L x 8.9 cm H (landscape)
  • High quality, full-colour, full-bleed printing on both sides
  • Add personal photos and text for no additional upcharge

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Custom Enchanted Daisy Baby Shower Thank You Card

Custom Enchanted Daisy Baby Shower Thank You Card

Express your gratitude with our "Custom Enchanted Daisy Baby Shower" thank you cards. These beautifully designed cards feature a sweet pastel daisy motif, making them a lovely way to show your appreciation. Customise the cards with your own heartfelt message, letting your guests know how much their presence meant to you. These thank you cards are the perfect finishing touch to your baby shower, allowing you to express your thanks in a personal and charming way. Your guests will cherish the thoughtful gesture and the beautiful design.

Customer Reviews

4.8 out of 5 stars rating3.7K Total Reviews
3212 total 5-star reviews267 total 4-star reviews61 total 3-star reviews29 total 2-star reviews103 total 1-star reviews
3,672 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous3 January 2024Verified Purchase
Flat Thank You Card, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Corner: Squared, Print Quality: Standard, Envelopes: White
Zazzle Reviewer Program
Really high quality beautiful design with beautiful colours and flowers. I was able to personalise these to suit different recipients and they looked really professional. The image quality was incredible and size was perfect. Print quality very good and colours are very accurate.
4 out of 5 stars rating
By Sarah G.24 June 2020Verified Purchase
Flat Thank You Card, Size: 8.9 cm x 12.7 cm, Paper: Signature Matte, Corner: Squared, Print Quality: Standard, Envelopes: White
Zazzle Reviewer Program
Overall the quality is excellent, however 2 edges of the card had a lime green colour and just needed to be guillotined off. I did complain to customer service and they sent me a replacement which was perfect. So as I result I have ordered more. The paper quality and print quality and top class.
5 out of 5 stars rating
By S.24 September 2021Verified Purchase
Flat Thank You Card, Size: 8.9 cm x 12.7 cm, Paper: Signature Matte, Corner: Squared, Print Quality: Standard, Envelopes: White
Zazzle Reviewer Program
This was excellent it said everything I want to say. Very good the picture was printed well

Tags

Flat Thank You Cards
watercolordaisydaisy baby showerfloral baby showerwhite daisywhimsicalmagicalpastelsimpleflowers
All Products
watercolordaisydaisy baby showerfloral baby showerwhite daisywhimsicalmagicalpastelsimpleflowers

Other Info

Product ID: 256515102053315731
Created on 16/06/2024, 3:06
Rating: G