Tap / click on image to see more RealViewsTM
Sale Price £1.87.  
Original Price £2.66 per card
You save 30%

Cute Girly Princess Crown Pink Photo Watercolor Invitation

Qty:
Choose Your Format
Squared
+£0.20
+£0.24
+£0.24
+£0.24
+£0.24
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+£1.44
+£0.59
+£0.59
-£0.16
+£0.59

Other designs from this category

Shop this collection

Ioana Nedelcu
PRINCESS BIRTHDAYDesigned by Ioana Nedelcu
Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from twelve unique paper types, two printing options, and six shape options to design a card that's perfect for you.

  • Dimensions: 12.7 cm x 17.8 cm (5"x 7") (portrait or landscape)
  • Standard white envelope included
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Two printing options available: Standard and High-Definition
  • 12 unique paper types and colours to choose from
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 cm x 17.8 cm (5"x 7"). For best results please add 0.15 cm (1/16") bleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Cute Girly Princess Crown Pink Photo Watercolor   Invitation

Cute Girly Princess Crown Pink Photo Watercolor Invitation

This cute modern Princess invitation is perfect for your daughter's royal birthday bash. This enchanting design features a delicate white crown motif and Cinderella's magical essence, set against a vibrant pink backdrop, exuding grace and sophistication. The minimalist crown adds a regal touch, accompanied by classic black and white text for clarity and style. Celebrate your little princess in a whimsical manner with this customisable invitation, where you can include her name in beautiful handwriting. Elevate the magic further by adding a customisable photo of your princess. Available in both print and digital download formats, it's the ultimate choice for a memorable celebration.

Customer Reviews

4.8 out of 5 stars rating69.6K Total Reviews
61772 total 5-star reviews5693 total 4-star reviews1003 total 3-star reviews463 total 2-star reviews715 total 1-star reviews
69,646 Reviews
Reviews for similar products
5 out of 5 stars rating
By Shirley F.15 November 2019Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Very easy to order. And design what you want printed. It turned out perfect and the card was top Quality. Also the envelopes are top quality . I was very happy.
5 out of 5 stars rating
By morgan g.22 April 2024Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Amazing, Beautiful quality!! Delivery said 18 working days but they came in 4 days!! So impressed by delivery and quality. Gorgeous vibrant colours
5 out of 5 stars rating
By Anonymous12 August 2025Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Just right for this special occasion. Arrived in just a few days giving plenty of time for RSVPs. One small problem which was mine entirely. I forgot to put the time on the invitation cards. Had to print out a small note to go with every invitation card. Moral of story - don’t be in a hurry and don’t press ‘send’ before reading everything carefully. .

Tags

Invitations
watercolorgirly pinkprincess birthday partywhite and pinkcinderellafairytalemagical fairyroyal5th birthdayphoto
All Products
watercolorgirly pinkprincess birthday partywhite and pinkcinderellafairytalemagical fairyroyal5th birthdayphoto

Other Info

Product ID: 256411210124026350
Created on 24/03/2024, 6:52
Rating: G