Tap / click on image to see more RealViewsTM
£16.75
per sticker
 

Cute Mermaid and Blowfish Tail Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 20.32 cm x 20.32 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 20.3 cm L x 8.12.7 cm W
  • Design Area: 20.3 cm L x 20.3 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Cute Mermaid and Blowfish Tail Sticker

Cute Mermaid and Blowfish Tail Sticker

Cute Mermaid and Blowfish Tail Sticker re cut to the exact shape of your image and produced using a custom cut (kiss-cut) process on vinyl sheets

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
925 total 5-star reviews68 total 4-star reviews27 total 3-star reviews30 total 2-star reviews93 total 1-star reviews
1,143 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kevin L.29 March 2021Verified Purchase
35.56 cm x 35.56 cm Custom-Cut Vinyl Stickers, Matte White
Creator Review
These stickers look and feel fantastic. The material is in a matte finish, and is the biggest size print (Extra-Large 35.6 x 35.6 cm). I love the bright colours. I’m super happy with all the prints had come out. It gives us great confidence of the products. The colours are bright and colourful and don’t run (something I was really worried about), and the look of them feels great.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Rebecca B.27 February 2024Verified Purchase
Zazzle Reviewer Program
Really beautiful decal sticker verse, Love how easy it is to take off and that some of the verse are not all together which gave me flexibility to move them about, came really quickly and safely in secure protective sturdy packaging, very happy with product ⭐️⭐️⭐️⭐️⭐️. Printing was great very clear and great quality
5.0 out of 5 stars rating
5 out of 5 stars rating
By Rebecca B.27 February 2024Verified Purchase
Zazzle Reviewer Program
Really beautiful decal sticker verse, Love how easy it is to take off and that some of the verse are not all together which gave me flexibility to move them about, came really quickly and safely in secure protective sturdy packaging, very happy with product ⭐️⭐️⭐️⭐️⭐️. Excellent quality and Very clear printing Love how some of the verse was separate really happy

Tags

Custom-Cut Vinyl Stickers
stickerscustom stickerszazzle comgoogle comnew arrivalsmermaidsfantasykidsstickers for kidsblowfish
All Products
stickerscustom stickerszazzle comgoogle comnew arrivalsmermaidsfantasykidsstickers for kidsblowfish

Other Info

Product ID: 256979921022671861
Created on 17/06/2021, 9:35
Rating: G