Sell on Zazzle
Tap / click on image to see more RealViewsTM
The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
£48.20
per clipboard
 

Daisy Chain - Clipboard (Bright Pink))

4.8 out of 5 stars rating
401 Total Reviews |
by
Qty:

Other designs from this category

About Clipboard

Sold by
Clipboard
Create your own from scratch

Style: Clipboard

Stay organised, and stunningly stylish, with custom clipboards from Zazzle! Use your favourite design, images or text to transform this basic school supply into a stunning accessory, that will keep you on track, always!

  • Dimensions: 31.75 cm L x 22.86 cm W (12.5" x 9"); thickness: 0.31 cm (0.125")
  • Designed for letter and A4 sized paper
  • Holds up to 1.27 cm (0.5") of paper securely
  • Made of ultra-durable acrylic
  • Printed on both sides
  • /!\WARNING: CHOKING HAZARD - small parts.
  • Not for children under 3 yrs.

About This Design

The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
Daisy Chain - Clipboard (Bright Pink))

Daisy Chain - Clipboard (Bright Pink))

A modern take on a sweet floral motif, Daisy Chain feels both playful and refined. The repeating pattern brings movement and rhythm, while the high-contrast palette keeps it crisp and graphic. Designed with a Scandinavian sensibility—simple, bold, and intentional—this adds personality without feeling overdone. It’s the kind of piece that stands out on its own but still works effortlessly with everything else you carry. Lighthearted, modern, and a little unexpected—this is everyday design done right.
dopaminedarling
Artwork designed by
United States
View their Store

Customer Reviews

4.8 out of 5 stars rating401 Total Reviews
359 total 5-star reviews27 total 4-star reviews5 total 3-star reviews7 total 2-star reviews3 total 1-star reviews
401 Reviews
Reviews for similar products
5 out of 5 stars rating
By Heather C.3 December 2018 • Verified Purchase
Clipboard
Zazzle Reviewer Program
I love the sparkly background that the designer made, I personalized it for my JP business so I can use it for work and it showcases my business name and team name. Hopefully when I can afford it, and I get some teamies as well. I will buy one for them too as a gift like other team leaders gives their teamies things to give back and encourage them. I can also use it to hold my notes when I go to local, national and abroad events. It is great quality and well made. The printing is awesome, it's bright and clear. It's printed on both sides really well. Just what I wanted. The board is very sturdy as well.
5 out of 5 stars rating
By A.18 March 2018 • Verified Purchase
Clipboard
Zazzle Reviewer Program
I wanted something different for my personal trainers birthday and found this funny clipboard.He absolutely loves it !Very pleased. Printing is excellent
5 out of 5 stars rating
By Patricia t.26 August 2023 • Verified Purchase
Clipboard
Zazzle Reviewer Program
I just wish it had a extra gloss texture to shine but I love it anyway!!! Thanks so much !!! .
from zazzle.com (US)

Tags

Clipboard
moderngraphicscandinavianfloralpreppyfemininegirlydaisylacepink
All Products
moderngraphicscandinavianfloralpreppyfemininegirlydaisylacepink

Other Info

Product ID: 256610188831088325
Created on 27/03/2026, 15:08
Rating: G