Tap / click on image to see more RealViewsTM
£10.80
£3.60 per sheet of tissue paper
 

Distressed Sun Decoupage Tissue Paper

Qty:

Other designs from this category

About Tissue Paper

Sold by

Size: 45.72 cm x 60.96 cm (18" x 24")

Make all of your gifts perfectly unique with personalised tissue paper. Give your gifts a sweet, personal touch with designs, photos, images, and text printed on this gift wrapping essential. Impress your friends and family with your amazing style!

  • Please note that this size tissue arrives folded
  • Dimensions: 45.72 cm L x 60.96 W (18”L x 24” W) unfolded
  • Full colour edge-to-edge print
  • 4535g (10lb) paper is great for wrapping jewellery, small gifts and party favours
  • 8164g (18lb) paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

Distressed Sun Decoupage Tissue Paper

Distressed Sun Decoupage Tissue Paper

Unleash the warmth and allure of the sun with this exquisite Distressed Sun Decoupage Tissue Paper. Its vintage-inspired design evokes a sense of nostalgic charm and tranquility. Crafted with meticulous detail, the tissue paper features a distressed sun motif, rendered in ethereal shades of gold and amber. The aged effect lends an air of timelessness, inviting you to create projects that resonate with both the past and present. Whether you’re a seasoned artist, a home décor enthusiast, or simply seeking to add a touch of warmth to your life, this high-quality tissue paper is the perfect companion. Its versatility allows you to transform ordinary surfaces into extraordinary works of art. -Distressed sun design for a vintage esthetic -Shimmering gold and amber hues add depth and warmth -Premium tissue paper ensures durability and ease of use -Ideal for découpage, mixed media, scrapbooking, and other creative projects.

Customer Reviews

4.8 out of 5 stars rating3K Total Reviews
2755 total 5-star reviews169 total 4-star reviews51 total 3-star reviews27 total 2-star reviews45 total 1-star reviews
3,047 Reviews
Reviews for similar products
5 out of 5 stars rating
By Erica E.3 May 2024Verified Purchase
Custom Tissue Paper - 15 gsm (10lb), Size: 25.4 cm x 35.56 cm (10" x 14")
The application of this decoupage paper was very simple , applied with PVA glue on a plywood surface. The colour stayed true to paper before application . I used cling film to apply over ply wood , no wrinkles , very pleased with the result.
5 out of 5 stars rating
By Hayley C.24 May 2020Verified Purchase
Custom Tissue Paper - 15 gsm (10lb), Size: 45.72 cm x 60.96 cm (18" x 24")
Zazzle Reviewer Program
I knew this would be stunning but it's even better than I expected! Really happy with my design and chuffed I picked this one. Be prepared to wait though if you choose the slowest delivery, took 3 weeks to come, but arrived within stated timeframe. Perfect imagery, colour and print, so easy to use the offcuts for spare bits...I only planned on doing the two back panels of my tv unit but ended up doing three other gaps!
5 out of 5 stars rating
By D.29 July 2022Verified Purchase
Zazzle Reviewer Program
High quality paper, beautiful design and perfect for decoupage. High quality and bright colours.
Original product

Tags

Tissue Paper
decoupagesunmagicmysticalancientfacepagannew agefantasysurreal
All Products
decoupagesunmagicmysticalancientfacepagannew agefantasysurreal

Other Info

Product ID: 256055763715191733
Created on 16/08/2024, 18:13
Rating: G