Tap / click on image to see more RealViewsTM
£7.05
per sheet of 20
 

Elegant black pink damask wedding square sticker

4.8 out of 5 stars rating
4132 Total Reviews
|
by
Qty:
Square Stickers
+£0.30
+£0.30
+£0.30

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Elegant black pink damask wedding square sticker

Elegant black pink damask wedding square sticker

Create your own elegant damask sticker with this customisable template. DESIGN ~ A rich, ornate, opulent and decadent "mother of pearl" dusky pink damask pattern forms a border around the edge of this beautiful square sticker, which is edged by a black border, followed by the same vibrant damask pattern found around the edge, and on top of this is a black square in the middle, which has a text template for your monogram or personal wording. CUSTOMIZE IT ~ Add your own wording and change the colour, style and size of the font to meet your unique requirements. MATCHING PAPER ACCESSORIES & GOODIES: See below this paragraph. IDEAL FOR ~ Any stylish and classy event, function, charity fundraising gathering or corporate banquet, as well as any breakfast / luncheon or dinner invitations. They are perfect for formal wedding, engagement, anniversary, graduation and housewarming special occasions too. If your business is celebrating a launch, year end function or opening night, your guests, suppliers and friends will be delighted with this stylish envelope seal for your invitations. STORE ADDRESS ~ http://www.zazzle.com/mensgifts* OTHER PRODUCTS YOU MIGHT ENJOY

Customer Reviews

4.8 out of 5 stars rating4.1K Total Reviews
3550 total 5-star reviews391 total 4-star reviews93 total 3-star reviews39 total 2-star reviews59 total 1-star reviews
4,132 Reviews
Reviews for similar products
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Elaine P.15 July 2023Verified Purchase
Zazzle Reviewer Program
Easy to order. Good size. Print quality brilliant. Will use to label my crafting boxes so that they are easily identifiable when borrowed! Easy to design. Great choice. Quality exceptional. Thoroughly recommend
5 out of 5 stars rating
By Carolyn S.20 May 2018Verified Purchase
Zazzle Reviewer Program
These classy stickers sit well on products they look good, the ink, quality of paper & glue enhances the durability of the product . I would recommend these. The printing is high quality, the style is vintage which is the look I was going for

Tags

Stickers
elegantblackpinkdamaskweddingclassystylishduskyvictorianelegant damask
All Products
elegantblackpinkdamaskweddingclassystylishduskyvictorianelegant damask

Other Info

Product ID: 217875311265782639
Created on 04/06/2011, 19:58
Rating: G