Tap / click on image to see more RealViewsTM
The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
£50.15
per clock
 

Elegant Blush Pink & Silver Glitter Drip Square Wall Clock

Qty:
27.3 cm Square Acrylic
-£5.75
-£11.40
-£11.40
-£11.40

Other designs from this category

About Wall Clocks

Sold by

Style: 27.3 cm Square Acrylic Wall Clock

Customise your wall clock to create a functional wall décor statement piece to perfectly match your home décor, show off your art or favourite photo, or give as a personalised gift. This unique, high-quality wall clock is vibrantly printed with AcryliPrint®HD process and features a pre-installed backside hanging slot for easy hanging and a non-ticking design.

  • Size: 27.30 cm L x 27.30 cm H (10.75" x 10.75")
  • Material: Grade-A acrylic
  • One AA battery required (not included)
  • Add photos, artwork, and text
  • Indoor use only, not recommended for outdoor use
California Residents: Prop 65 Disclaimer
WarningWARNING: This product can expose you to chemicals including lead, which is known to the State of California to cause cancer and birth defects or other reproductive harm. For more information, go to www.P65Warnings.ca.gov.

About This Design

The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
Elegant Blush Pink & Silver Glitter Drip  Square Wall Clock

Elegant Blush Pink & Silver Glitter Drip Square Wall Clock

Add a touch of luxury to your space with this elegant Pink Luxe Drip wall clock, featuring shimmering silver and blush pink glitter drips in a circular-shaped motif. Perfect for glam rooms, modern bedrooms, or feminine office décor, this chic timepiece is as functional as it is fabulous. A stunning gift for housewarmings, birthdays, or anyone who loves a little sparkle!

Customer Reviews

4.7 out of 5 stars rating3.7K Total Reviews
3064 total 5-star reviews398 total 4-star reviews83 total 3-star reviews44 total 2-star reviews68 total 1-star reviews
3,657 Reviews
Reviews for similar products
5 out of 5 stars rating
By S.19 January 2019Verified Purchase
Wall Clock, 27.3 cm Square Acrylic
Zazzle Reviewer Program
Just love the idea of being able to personalise items for dirfferent people and occasions. Great quality photos. Great quality printing. Happy with how the photos look.
5 out of 5 stars rating
By Joe U.27 January 2023Verified Purchase
Wall Clock, 27.3 cm Square Acrylic
Zazzle Reviewer Program
Came in reasonable time especially since it was overseas shipping and more importantly I'm blown away by the quality. Its not just a cheaply printed picture but acryclic or some other transparent material bonded to the pic. As an added bonus, the clock doesn't make a ticking noise but is silent. Printing / image quality is exactly as i envisaged if not better. Its difficult to get a picture that just right for this use but the one i had worked nicely with white letters, i can imagine some other photos i had would have worked equally well with black. Very happy customer.
5 out of 5 stars rating
By Tracy I.7 February 2021Verified Purchase
Wall Clock, 27.3 cm Square Acrylic
Zazzle Reviewer Program
Absolutely love this clock. A modern looking clock and the pictures are a great way of personalising. The photos for the size were of good clear quality.

Tags

All Products
sparkleglittermodernglamelegantgirlysilverpink

Other Info

Product ID: 256577969356106432
Created on 04/09/2025, 12:24
Rating: G