Tap / click on image to see more RealViewsTM
The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
£50.15
per clock
 

Elegant Blush Pink & Silver Glitter Drip Square Wall Clock

Qty:
27.3 cm Square Acrylic
-£5.75
-£11.40
-£11.40
-£11.40

Other designs from this category

About Wall Clocks

Sold by

Style: 27.3 cm Square Acrylic Wall Clock

Customise your wall clock to create a functional wall décor statement piece to perfectly match your home décor, show off your art or favourite photo, or give as a personalised gift. This unique, high-quality wall clock is vibrantly printed with AcryliPrint®HD process and features a pre-installed backside hanging slot for easy hanging and a non-ticking design.

  • Size: 27.30 cm L x 27.30 cm H (10.75" x 10.75")
  • Material: Grade-A acrylic
  • One AA battery required (not included)
  • Add photos, artwork, and text
  • Indoor use only, not recommended for outdoor use

About This Design

The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
Elegant Blush Pink & Silver Glitter Drip  Square Wall Clock

Elegant Blush Pink & Silver Glitter Drip Square Wall Clock

Add a touch of luxury to your space with this elegant Pink Luxe Drip wall clock, featuring shimmering silver and blush pink glitter drips in a circular-shaped motif. Perfect for glam rooms, modern bedrooms, or feminine office décor, this chic timepiece is as functional as it is fabulous. A stunning gift for housewarmings, birthdays, or anyone who loves a little sparkle!

Customer Reviews

4.7 out of 5 stars rating3.7K Total Reviews
3091 total 5-star reviews401 total 4-star reviews84 total 3-star reviews46 total 2-star reviews70 total 1-star reviews
3,692 Reviews
Reviews for similar products
5 out of 5 stars rating
By S.19 January 2019Verified Purchase
Wall Clock, 27.3 cm Square Acrylic
Zazzle Reviewer Program
Just love the idea of being able to personalise items for dirfferent people and occasions. Great quality photos. Great quality printing. Happy with how the photos look.
5 out of 5 stars rating
By G.15 September 2020Verified Purchase
Zazzle Reviewer Program
The clock is a fantastic quality and was carefully packaged for delivery, it's absolutely perfect! It was produced quickly but perfectly, the tracking of the package was amazing and arrived in mint condition. Highly recommend this product. It's amazing, 100% perfect, we love it.
Original product
5 out of 5 stars rating
By E.24 December 2019Verified Purchase
Wall Clock, 27.3 cm Square Acrylic
Zazzle Reviewer Program
I was looking for a clock like this. And i found it on your website. It's perfect and I'm very happy about that. The picture quality is very good. It's very lovely clock. Good work. Thank you.

Tags

All Products
sparkleglittermodernglamelegantgirlysilverpink

Other Info

Product ID: 256577969356106432
Created on 04/09/2025, 12:24
Rating: G