Tap / click on image to see more RealViewsTM
Sale Price £2.36.  
Original Price £3.14 per card
You save 25%

Elegant Leafy Art Nouveau Arts and Crafts Pattern Invitation

Qty:
Choose Your Format
Squared
+£0.20
+£0.24
+£0.24
+£0.24
+£0.24
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+£1.67
+£0.67
+£0.67
+£0.67
-£0.18

Other designs from this category

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from various curated paper types, shapes and sizes to design a card that's perfect for you.

  • Dimensions: 12.7 cm x 17.8 cm (portrait or landscape)
  • Envelopes included but can be removed if not needed
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Various curated paper types to choose from
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 cm x 17.8 cm. For best results please add 0.16 cm bleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Elegant Leafy Art Nouveau Arts and Crafts Pattern Invitation

Elegant Leafy Art Nouveau Arts and Crafts Pattern Invitation

Chic vintage look with a customisable background colour. Original leave pattern motif by Village Design.

Customer Reviews

4.8 out of 5 stars rating70.6K Total Reviews
62453 total 5-star reviews5735 total 4-star reviews1059 total 3-star reviews498 total 2-star reviews817 total 1-star reviews
70,562 Reviews
Reviews for similar products
2 out of 5 stars rating
By Anonymous18 October 2025Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Ordered from the same collection but the colours are mismatched. Really disappointed in the products .
5 out of 5 stars rating
By Shirley F.15 November 2019Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Very easy to order. And design what you want printed. It turned out perfect and the card was top Quality. Also the envelopes are top quality . I was very happy.
5 out of 5 stars rating
By L.4 August 2022Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
So happy with the outcome! They are absolutely perfect, just what I imagined and more. Will be rrcommending this site to family and friends. Thank you. Printing was clear and visable. I was a little worried as one side was blue but it turned out great.

Tags

All Products
art nouveauvintagevictorianpatternleavesleafygreentealaquaelegant

Other Info

Product ID: 161983976605672037
Created on 29/10/2012, 14:02
Rating: G