Create stunning personalised Valentine's Day Cards today!   |   Browse our Valentine's Day Hub for the cutest custom gifts

Elegant Leafy Art Nouveau Arts and Crafts Pattern Mouse Mat

£11.05

per mousepad

Qty:
1
 
  • Front
    Front
Elegant Leafy Art Nouveau Arts and Crafts Pattern Mouse Mat
Designed for youby Village Design
Personalise this template
Style
Select an option:
Details
Mousepad
 
About This Product
  • Sold by
Style: Mousepad

Create a great accessory for the only mouse you want scurrying around with a custom mouse mat for your home or office! Decorate it with your favourite image or choose from thousands of designs that look great and protect your mouse from scratches and debris. You can also design fun mouse mats to hand out to new employees or to use as marketing materials!

  • Dimensions: 23.5 cm l x 19.7 cm w
  • High quality, full-colour printing
  • Durable and dust and stain resistant cloth cover
  • Non-slip backing
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 23.5 cm x 19.7 cm.
About This Design
Elegant Leafy Art Nouveau Arts and Crafts Pattern Mouse Mat
Chic vintage look with a customisable background colour. Original leave pattern motif by Village Design.
available on 11 products
Create stunning personalised Valentine's Day Cards today!   |   Browse our Valentine's Day Hub for the cutest custom gifts
Reviews
There are no reviews for this product yet.
Have you purchased this product? Write a review!
Tags
Mouse pads

art nouveau

vintage

victorian

pattern

leaves

leafy

green

teal

aqua

elegant

All Products:
art nouveauvintagevictorianpatternleavesleafygreentealaquaelegant
Other Info
Product ID: 144388314163988114
Created on
Recently Viewed Items