Tap / click on image to see more RealViewsTM
£16.70
per mouse mat
 

Elegant Leafy Art Nouveau Arts and Crafts Pattern Mouse Mat

Qty:
Personalise this template

Other designs from this category

About Mousepads

Sold by

Style: Mouse Pad

Create a great accessory for the only mouse you want scurrying around with a custom mouse pad for your home or office! Decorate it with your favourite image or choose from thousands of designs that look great and protect your mouse from scratches and debris. You can also design fun mouse pads to hand out to new employees or to use as marketing materials!

  • Dimensions: 23.49 cm (9.25") l x 19.68 cm (7.75")w
  • High quality, full-colour printing
  • Durable and dust and stain resistant cloth cover
  • Non-slip rubber backing
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 23.49 cm (9.25") x 19.68 cm (7.75")

About This Design

Elegant Leafy Art Nouveau Arts and Crafts Pattern Mouse Mat

Elegant Leafy Art Nouveau Arts and Crafts Pattern Mouse Mat

Chic vintage look with a customisable background colour. Original leave pattern motif by Village Design.

Customer Reviews

4.8 out of 5 stars rating4.8K Total Reviews
4276 total 5-star reviews393 total 4-star reviews76 total 3-star reviews28 total 2-star reviews28 total 1-star reviews
4,801 Reviews
Reviews for similar products
5 out of 5 stars rating
By kristiina i.8 August 2020Verified Purchase
Mouse Mat
Zazzle Reviewer Program
Great highquality product! nice material and good size. Printing shows my photo perfectly, the colours are just fine and because of so nice printed, the mousepad is nice to watch.
5 out of 5 stars rating
By Shirley H.7 June 2024Verified Purchase
Mouse Mat
Creator Review
I love Zazzle Mouse mats, they are lovely quality, wash well and last for, well I never had one wear out, I just wanted a change, so purchased another. They make great gifts. Printing perfect, bright and clear.
5 out of 5 stars rating
By scott a.11 August 2023Verified Purchase
Mouse Mat
Zazzle Reviewer Program
Seems to be made of good quality rubber, it is thicker than my current one, which really shows that they have taken their time to get quality materials. So far so good , i am very pleased. The product is very vibrant and exactly as it shows on the website!

Tags

Mousepads
art nouveauvintagevictorianpatternleavesleafygreentealaquaelegant
All Products
art nouveauvintagevictorianpatternleavesleafygreentealaquaelegant

Other Info

Product ID: 144388314163988114
Created on 29/10/2012, 14:02
Rating: G