Tap / click on image to see more RealViewsTM
Sale Price £7.16.  
Original Price £8.95 per sheet of 20
You save 20%

Elegant Navy Typographic Love Thanks Square Sticker

Wedding Collection
Qty:
  1. Shape

  2. Format

  3. Size

  4. Paper Type

Other designs from this category

Shop this collection

Member
Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Elegant Navy Typographic Love Thanks Square Sticker

Elegant Navy Typographic Love Thanks Square Sticker

This wedding sticker features a clean, modern design with a deep navy blue colour palette that exudes elegance and sophistication. The layout is minimalistic, focusing on bold sans-serif typography paired with a flowing cursive script for the word "and," creating a dynamic visual hierarchy. The phrase "LOVE and THANKS" is prominently displayed, conveying warmth and gratitude, while customisable names can be added below in a simple, all-caps font. Perfect for adding a personal touch to wedding favours or gifts, this sticker captures the heartfelt tone of your special day.

Customer Reviews

4.7 out of 5 stars rating4.3K Total Reviews
3621 total 5-star reviews405 total 4-star reviews104 total 3-star reviews55 total 2-star reviews77 total 1-star reviews
4,262 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous1 April 2026Verified Purchase
Simple yet perfect addition that finished off our wedding invites .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Elaine P.15 July 2023Verified Purchase
Zazzle Reviewer Program
Easy to order. Good size. Print quality brilliant. Will use to label my crafting boxes so that they are easily identifiable when borrowed! Easy to design. Great choice. Quality exceptional. Thoroughly recommend

Tags

Stickers
minimalisticweddingstickernavybluecolourpalettemodernelegancebold
All Products
minimalisticweddingstickernavybluecolourpalettemodernelegancebold

Other Info

Product ID: 256777587176174396
Created on 27/01/2026, 8:52
Rating: G