Tap / click on image to see more RealViewsTM
£2.57
per card
 

Elegant Script Botanical Christmas Photo Collage Holiday Card

Qty:
Choose Your Format
Squared
+£0.20
+£0.24
+£0.24
+£0.24
+£0.24
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+£0.64
-£0.16

Other designs from this category

About Flat Holiday Cards

Sold by

Size: 12.7 cm x 17.8 cm

Spread joy, share cheer, merry everything and a happy always! Holiday cards designed to brighten up the entire year.

  • Dimensions: 12.7 cm L x 17.8 cm H (portrait); 17.8 cm L x 12.7 cm H (landscape)
  • High quality, full-colour, full-bleed printing on both sides
  • Add photos and text for no additional charge

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Elegant Script Botanical Christmas Photo Collage Holiday Card

Elegant Script Botanical Christmas Photo Collage Holiday Card

This multi-photo Christmas holiday card is a perfect choice this Christmas season! It features a photo collage of three favourite family photos on the top. Underneath there are your Christmas greetings in a modern whimsical elegant script. Below is your family name and year in a simple typography. The card is framed on the bottom by lovely watercolor greenery: eucalyptus and red winter berries. The reverse of the card features the same botanical motif as well as your custom Christmas wishes! Create your own perfect Christmas greeting card by clicking on the ´´Personalise´´ button and changing the pictures and wording to your own!

Customer Reviews

4.7 out of 5 stars rating10.1K Total Reviews
8333 total 5-star reviews1216 total 4-star reviews250 total 3-star reviews126 total 2-star reviews208 total 1-star reviews
10,133 Reviews
4 out of 5 stars rating
By James C.4 December 2024Verified Purchase
Flat Holiday Card, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Corner: Squared, Envelopes: White
Beautiful cards, I am very pleased with the results. A few friends and family have already texted me to tell me how beautiful this year's card is, simple yet elegant. I will definitely buy my Christmas cards from Zazzle in the future. .
from zazzle.com (US)
Reviews for similar products
5 out of 5 stars rating
By Jacqueline W.27 December 2023Verified Purchase
Flat Holiday Card, Size: 10.8 cm x 14 cm, Paper: Signature Matte, Corner: Squared, Envelopes: White
Creator Review
Arrived on time and is very good quality. I was very happy with the quality of the card and the image.
5 out of 5 stars rating
By Anonymous3 January 2026Verified Purchase
Flat Holiday Card, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Corner: Squared, Envelopes: White
Great selection of cards and an easy to use website with simple editing. The cards arrived really quickly and were great quality. .

Tags

Flat Holiday Cards
christmas greenerywatercolorbotanicalphoto collagemulti photo christmasmodernscriptelegantwhimsicalfamily photos christmas holidays
All Products
christmas greenerywatercolorbotanicalphoto collagemulti photo christmasmodernscriptelegantwhimsicalfamily photos christmas holidays

Other Info

Product ID: 256903441749600233
Created on 26/09/2023, 23:53
Rating: G