Tap / click on image to see more RealViewsTM
Sale Price £1.93.  
Original Price £2.57 per card
You save 25%

Elegant Script Botanical Christmas Photo Collage Holiday Card

Qty:
Choose Your Format
Squared
+£0.20
+£0.24
+£0.24
+£0.24
+£0.19
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-£0.16
+£0.64
+£0.64
+£1.49
+£0.64

Other designs from this category

About Flat Holiday Cards

Sold by

Size: 12.7 cm x 17.8 cm

Spread joy, share cheer, merry everything and a happy always! Holiday cards designed to brighten up the entire year.

  • Dimensions: 12.7 cm L x 17.8 cm H (5" x 7)(portrait); 17.8 cm L x 12.7 cm H (7" x 5")(landscape)
  • High quality, full-colour, full-bleed printing on both sides
  • Add photos and text for no additional charge

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Elegant Script Botanical Christmas Photo Collage Holiday Card

Elegant Script Botanical Christmas Photo Collage Holiday Card

This multi-photo Christmas holiday card is a perfect choice this Christmas season! It features a photo collage of three favourite family photos on the top. Underneath there are your Christmas greetings in a modern whimsical elegant script. Below is your family name and year in a simple typography. The card is framed on the bottom by lovely watercolor greenery: eucalyptus and red winter berries. The reverse of the card features the same botanical motif as well as your custom Christmas wishes! Create your own perfect Christmas greeting card by clicking on the ´´Personalise´´ button and changing the pictures and wording to your own!

Customer Reviews

4.8 out of 5 stars rating9.5K Total Reviews
7925 total 5-star reviews1169 total 4-star reviews207 total 3-star reviews80 total 2-star reviews95 total 1-star reviews
9,476 Reviews
4 out of 5 stars rating
By James C.4 December 2024Verified Purchase
Flat Holiday Card, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Corner: Squared, Envelopes: White
Beautiful cards, I am very pleased with the results. A few friends and family have already texted me to tell me how beautiful this year's card is, simple yet elegant. I will definitely buy my Christmas cards from Zazzle in the future. .
from zazzle.com (US)
Reviews for similar products
5 out of 5 stars rating
By Jacqueline W.27 December 2023Verified Purchase
Flat Holiday Card, Size: 10.8 cm x 14 cm, Paper: Signature Matte, Corner: Squared, Envelopes: White
Creator Review
Arrived on time and is very good quality. I was very happy with the quality of the card and the image.
5 out of 5 stars rating
By Margaret S.31 March 2022Verified Purchase
Flat Holiday Card, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Corner: Squared, Envelopes: White
Zazzle Reviewer Program
So very happy with the quality of the cards . Colours where fab and just loved the message in side

Tags

Flat Holiday Cards
christmas greenerywatercolorbotanicalphoto collagemulti photo christmasmodernscriptelegantwhimsicalfamily photos christmas holidays
All Products
christmas greenerywatercolorbotanicalphoto collagemulti photo christmasmodernscriptelegantwhimsicalfamily photos christmas holidays

Other Info

Product ID: 256903441749600233
Created on 26/09/2023, 23:53
Rating: G