Tap / click on image to see more RealViewsTM
£21.25
per keychain
 

Elegant Thanksgiving Pear Wreath Illustration Key Ring

Qty:
Square (single-sided)

Other designs from this category

About Key Chains

Sold by

Shape: Square (single-sided)

Never leave home without your favourite photo, design, or inspirational message attached to your keys with this custom circle key ring. Designed to withstand daily wear and tear, this key ring displays designs, text, and photos in vibrant clarity and brilliant colours.

  • Dimensions: 4.7 cm x 4.7 cm (1.875" x 1.875")
  • Made of ultra-durable acrylic
  • UV resistant and waterproof
Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 4.7 cm x 4.7 cm (1.875" x 1.875"). For best results please add 0.15 cm (.12") bleed..

About This Design

Elegant Thanksgiving Pear Wreath Illustration Key Ring

Elegant Thanksgiving Pear Wreath Illustration Key Ring

Modern Thanksgiving Wreath Fall Motif Elements for Thanksgiving Gifts

Customer Reviews

4.8 out of 5 stars rating974 Total Reviews
865 total 5-star reviews76 total 4-star reviews15 total 3-star reviews7 total 2-star reviews11 total 1-star reviews
974 Reviews
Reviews for similar products
4 out of 5 stars rating
By Anonymous1 October 2025Verified Purchase
Acrylic Key Ring, Square (single-sided)
Long time from ordering to delivert.
5 out of 5 stars rating
By Joanna B.20 March 2022Verified Purchase
Acrylic Key Ring, Square (single-sided)
Creator Review
This key ring is fabulous. It's really well made. The printing is great; really sharp and clear.
5 out of 5 stars rating
By J.13 August 2024Verified Purchase
I adore the sentiment behind this keychain, which is why I chose it as a gift. This keychain features a beautifully polished, shiny finish.
from zazzle.com (US)
Original product

Tags

Key Chains
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath
All Products
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath

Other Info

Product ID: 256155350948813937
Created on 01/11/2020, 6:35
Rating: G