Tap / click on image to see more RealViewsTM
£24.30
per keychain
 

Elegant Thanksgiving Pear Wreath Illustration Key Ring

Qty:
Personalise this template
Square (single-sided)

Other designs from this category

About Key Chains

Sold by

Shape: Square (single-sided)

Never leave home without your favourite photo, design, or inspirational message attached to your keys with this custom circle key ring. Designed to withstand daily wear and tear, this key ring displays designs, text, and photos in vibrant clarity and brilliant colours.

  • Dimensions: 4.7 cm x 4.7 cm (1.875" x 1.875")
  • Made of ultra-durable acrylic
  • UV resistant and waterproof
Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 4.7 cm x 4.7 cm (1.875" x 1.875"). For best results please add 0.15 cm (.12") bleed..

About This Design

Elegant Thanksgiving Pear Wreath Illustration Key Ring

Elegant Thanksgiving Pear Wreath Illustration Key Ring

Modern Thanksgiving Wreath Fall Motif Elements for Thanksgiving Gifts

Customer Reviews

4.8 out of 5 stars rating966 Total Reviews
859 total 5-star reviews76 total 4-star reviews14 total 3-star reviews7 total 2-star reviews10 total 1-star reviews
966 Reviews
Reviews for similar products
4 out of 5 stars rating
By Anonymous1 October 2025Verified Purchase
Acrylic Key Ring, Square (single-sided)
Long time from ordering to delivert.
5 out of 5 stars rating
By Joanna B.20 March 2022Verified Purchase
Acrylic Key Ring, Square (single-sided)
Creator Review
This key ring is fabulous. It's really well made. The printing is great; really sharp and clear.
5 out of 5 stars rating
By Beauty D.11 December 2019Verified Purchase
Acrylic Key Ring, Square (single-sided)
Zazzle Reviewer Program
The customer is satisfied. The print out came out perfect.
from zazzle.com (US)

Tags

Key Chains
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath
All Products
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath

Other Info

Product ID: 256155350948813937
Created on 01/11/2020, 6:35
Rating: G