Tap / click on image to see more RealViewsTM
£56.25
per set of 50 napkins
 

Elegant Thanksgiving Pear Wreath Illustration Napkin

Qty:
White

Other designs from this category

About Paper Napkins

Sold by

Style: Standard Cocktail

A good celebration is as much about the presentation as it is about food. Serve up the party with custom personalised paper napkins that look good tucked in the collar or draped over your lap.

  • Dimensions: 12 cm l x 12 w cm (folded), 3 ply
  • Printed in full colour on your choice of white or ecru coloured napkins
  • Coined or standard napkin styles available
  • Sold in quantities of 50
  • Buy in bulk and save!
  • This product is food contact safe
Tip: When ordering napkins, the general rule is 3 napkins per guest.

About This Design

Elegant Thanksgiving Pear Wreath Illustration Napkin

Elegant Thanksgiving Pear Wreath Illustration Napkin

Modern Thanksgiving Wreath Fall Motif Elements for Thanksgiving Gifts

Customer Reviews

4.6 out of 5 stars rating109 Total Reviews
86 total 5-star reviews12 total 4-star reviews4 total 3-star reviews2 total 2-star reviews5 total 1-star reviews
109 Reviews
Reviews for similar products
4 out of 5 stars rating
By Mrs B.5 May 2022Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
Adequate for purpose. More expensive than I would have liked but good momento of special family birthday and rare occasion since lockdown. Colours ok, not as deep as expected. Printing ok, letters not as crisp as expected.
4 out of 5 stars rating
By MRS C.2 September 2024Verified Purchase
Paper Napkins, Standard Cocktail
Great napkin but I was expecting more of a linen touch quality, especially for the price .
5 out of 5 stars rating
By Sally R.24 June 2019Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
Lovely thick napkins. Everyone commented on how good they looked. Good reproduction of a photo

Tags

Paper Napkins
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath
All Products
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath

Other Info

Product ID: 256037812667762383
Created on 01/11/2020, 6:06
Rating: G