Tap / click on image to see more RealViewsTM
Sale Price £8.36.  
Original Price £10.45 per sheet of 20
You save 20%

Elf Designs :: Magical by MarloDee Designs Square Sticker

Qty:
Square Stickers
+£0.40
+£0.40
+£0.40

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Elf Designs :: Magical by MarloDee Designs Square Sticker

Elf Designs :: Magical by MarloDee Designs Square Sticker

A lovely elf and a hummingbird together is Magical....( © 2004-2015 MarloDee Designs (www.marlodeedesigns.com) : All rights reserved. Images on this site are not public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing.

Customer Reviews

4.8 out of 5 stars rating27.5K Total Reviews
23782 total 5-star reviews2247 total 4-star reviews586 total 3-star reviews369 total 2-star reviews562 total 1-star reviews
27,546 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Rebecca B.28 November 2024Verified Purchase
Very happy with these lip balm stickers, great quality and fit perfectly and stick solid to lip tube, my lip balm stickers from previous supplier just kept coming unstuck straight away so wasn’t sure how these would be so didn’t order loads but I thought I would give this supplier a try, they are really good and no issues with coming unstuck. Very happy and will be ordering more, Thank You ⭐️⭐️⭐️⭐️⭐️.
5.0 out of 5 stars rating
5 out of 5 stars rating
By James W.29 June 2025Verified Purchase
I was recently using these to draw attention to the souless "Metal Culture" organisation that took over Chalkwell Park, and to just raise awareness of Cult Phenomena in General.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anita H.11 June 2022Verified Purchase
Zazzle Reviewer Program
Thanks so much for this high quality sticker for my lash business, everyone has said how unreal they look! High definition, beautiful glossy finish, absolutely love them!

Tags

Stickers
elffairyfaemagicmagikmagikalwitchhummingbirdfantasyspell
All Products
elffairyfaemagicmagikmagikalwitchhummingbirdfantasyspell

Other Info

Product ID: 217259878938441739
Created on 11/10/2011, 13:05
Rating: G