Tap / click on image to see more RealViewsTM
Sale Price £8.36.  
Original Price £10.45 per sheet of 20
You save 20%

Elf with White Cat Riding on a Leaf Stickers 2

Qty:
  1. Shape

  2. Format

  3. Size

  4. Paper Type

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Elf with White Cat Riding on a Leaf Stickers 2

Elf with White Cat Riding on a Leaf Stickers 2

these are lovely for your scrapbooking projects - to label items - or just envelope seals... © 2004-2015 MarloDee Designs (www.marlodeedesigns.com) : All rights reserved. Images on this site are not public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing.

Customer Reviews

4.8 out of 5 stars rating27.6K Total Reviews
23812 total 5-star reviews2251 total 4-star reviews596 total 3-star reviews375 total 2-star reviews568 total 1-star reviews
27,602 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Rebecca B.28 November 2024Verified Purchase
Very happy with these lip balm stickers, great quality and fit perfectly and stick solid to lip tube, my lip balm stickers from previous supplier just kept coming unstuck straight away so wasn’t sure how these would be so didn’t order loads but I thought I would give this supplier a try, they are really good and no issues with coming unstuck. Very happy and will be ordering more, Thank You ⭐️⭐️⭐️⭐️⭐️.
5.0 out of 5 stars rating
5 out of 5 stars rating
By James W.29 June 2025Verified Purchase
I was recently using these to draw attention to the souless "Metal Culture" organisation that took over Chalkwell Park, and to just raise awareness of Cult Phenomena in General.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous8 September 2025Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .

Tags

Stickers
fantasyfaefairyelfelveselvishmagicspellmother naturebeautiful
All Products
fantasyfaefairyelfelveselvishmagicspellmother naturebeautiful

Other Info

Product ID: 217199683751234378
Created on 11/10/2011, 13:03
Rating: G