Tap / click on image to see more RealViewsTM
£10.00
per sheet of 6
 

Emergency Alert Save My Pets Stickers

Qty:
Square Stickers
+£0.35
+£0.35
+£0.35

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Emergency Alert Save My Pets Stickers

Emergency Alert Save My Pets Stickers

These emergency alert stickers are perfect for the pet lover! The text reads In Case of Emergency Save My Pets, with a place to write in the number of cats or dogs and contact numbers for you or your vet. The sticker can be customised to replace the provided text with your printed text. Affix one to your entrance and exit doors and windows so emergency personnel will know you have pets inside your home. The stickers are a part of the Just Love Rescues emergency alert line, including Emergency magnets, Home Alone cards and keychains.

Customer Reviews

4.8 out of 5 stars rating27.3K Total Reviews
23627 total 5-star reviews2231 total 4-star reviews568 total 3-star reviews350 total 2-star reviews525 total 1-star reviews
27,301 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous8 September 2025Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Tim S.23 October 2017Verified Purchase
Zazzle Reviewer Program
Brilliant quality stickers perfect for Branding my business products. Perfect printing, excellent quality paper and finish.

Tags

Stickers
emergencyalertpetstickerscasesavepetscontactvetphone
All Products
emergencyalertpetstickerscasesavepetscontactvetphone

Other Info

Product ID: 217631650581201911
Created on 30/04/2016, 12:24
Rating: G