Tap / click on image to see more RealViewsTM
£7.45
per sheet of 6
 

Emergency Alert Save My Pets Stickers

Qty:
Square Stickers
+£0.30
+£0.30
+£0.30

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Emergency Alert Save My Pets Stickers

Emergency Alert Save My Pets Stickers

These emergency alert stickers are perfect for the pet lover! The text reads In Case of Emergency Save My Pets, with a place to write in the number of cats or dogs and contact numbers for you or your vet. The sticker can be customised to replace the provided text with your printed text. Affix one to your entrance and exit doors and windows so emergency personnel will know you have pets inside your home. The stickers are a part of the Just Love Goldens emergency alert line, including Emergency magnets, Home Alone cards and keychains.

Customer Reviews

4.8 out of 5 stars rating27K Total Reviews
23419 total 5-star reviews2220 total 4-star reviews543 total 3-star reviews318 total 2-star reviews478 total 1-star reviews
26,978 Reviews
5 out of 5 stars rating
By Judy T.3 December 2018Verified Purchase
Zazzle Reviewer Program
Have been searching for such an item for quite some time. So glad to have found them and although I hope we never experience such an emergency, it's a relief to know that the information is available, just in case. Colors are bright and eye-catching. Just what you'd want to attract attention in case of an emergency.
from zazzle.com (US)
Reviews for similar products
5 out of 5 stars rating
By Anonymous8 September 2025Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.

Tags

Stickers
emergencyalertpetstickerscasesavepetscontactvetphone
All Products
emergencyalertpetstickerscasesavepetscontactvetphone

Other Info

Product ID: 217723209636092822
Created on 30/04/2016, 12:31
Rating: G