Tap / click on image to see more RealViewsTM
£8.95
per sheet of 20
 

Espeon Evolution Purple Psychic Pokemon Sticker |

Qty:
Square Stickers
+£0.30
+£0.30
+£0.30

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Espeon Evolution Purple Psychic Pokemon Sticker |

Espeon Evolution Purple Psychic Pokemon Sticker |

Introducing the stunning Espeon Evolution sticker from the Eevee Evolution collection! This premium anime-inspired sticker features Espeon, the psychic-type Pokémon evolution with gorgeous purple coloring and mystical design. ✨ PRODUCT HIGHLIGHTS: • Authentic Espeon character from Eevee Evolution series • Perfect for Pokémon fans and anime enthusiasts • High-quality printed sticker with vibrant colors • Ideal for laptops, water bottles, phone cases, and more • Official Eevee Evolution fan art style 🎮 PERFECT FOR: - Pokémon collectors and fans - Anime and manga lovers - Eevee Evolution series enthusiasts - Gaming merchandise collections - Gift for psychic-type Pokémon fans Add this exclusive Espeon Evolution sticker to your collection today and show your love for this iconic Pokémon character!

Customer Reviews

4.8 out of 5 stars rating27.3K Total Reviews
23634 total 5-star reviews2231 total 4-star reviews569 total 3-star reviews350 total 2-star reviews528 total 1-star reviews
27,312 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous8 September 2025Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Tim S.23 October 2017Verified Purchase
Zazzle Reviewer Program
Brilliant quality stickers perfect for Branding my business products. Perfect printing, excellent quality paper and finish.

Tags

Stickers
eeveeevolutionpokemonstickeranimegamingpsychicfanart
All Products
eeveeevolutionpokemonstickeranimegamingpsychicfanart

Other Info

Product ID: 256389457955600169
Created on 18/12/2025, 9:37
Rating: G