Tap / click on image to see more RealViewsTM
Sale Price £2.56.  
Original Price £3.41 per card
You save 25%

Fairy Circle by Arthur Rackham Card

Qty:
Choose Your Format
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+£0.60
-£0.15

Other designs from this category

About Folded Greeting Cards

Sold by

Size: Standard, 12.7 cm x 17.8 cm

Thank you, hello, or I love you, custom greeting cards are thoughtful gifts that are always the perfect way to express yourself.

  • Dimensions: 12.7 cm x 17.78 cm (portrait); 17.78 cm x 12.7 cm (landscape)
  • Full color CMYK print process
  • Double sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Fairy Circle by Arthur Rackham Card

Fairy Circle by Arthur Rackham Card

The fairies are celebrating. It is for A Midsummer Night's Dream. The colours are great. It is public domain.

Customer Reviews

4.9 out of 5 stars rating18.3K Total Reviews
17143 total 5-star reviews795 total 4-star reviews147 total 3-star reviews78 total 2-star reviews150 total 1-star reviews
18,313 Reviews
Reviews for similar products
5 out of 5 stars rating
By Pat M.1 September 2025Verified Purchase
Folded Greeting Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Thank you Colana for the perfect custom made Mass Card. It's for my brother-in-law's birthday on 5th October, St. Faustina's Feast day! So very pleased with quality of the card and the personalisation - really beautiful! Shower of Roses Shoppe is my go to for future cards and highly recommend. .
5 out of 5 stars rating
By Gary C.17 January 2021Verified Purchase
Folded Greeting Card, Size: Small, 10.2 cm x 14.2 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I Design It And So Perfect 😍👌🏼 That What I ask For. Printing It So Good And Perfect 😍👌🏼
5 out of 5 stars rating
By MARWA A.23 October 2021Verified Purchase
Folded Greeting Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I think it’s great how you can design your own cards and buy them and they’re not even expensive which is really good. The printing turned even better than I expected

Tags

Folded Greeting Cards
fairiesfairyartarthurrackhamshakespearetreeplaywhite
All Products
fairiesfairyartarthurrackhamshakespearetreeplaywhite

Other Info

Product ID: 256603442933343167
Created on 19/03/2019, 21:05
Rating: G