Tap / click on image to see more RealViewsTM
£3.41
per card
 

Fairy Circle by Arthur Rackham Card

Qty:
Choose Your Format
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+£0.60
-£0.15

Other designs from this category

About Folded Greeting Cards

Sold by

Size: 12,7 × 17,8 cm

Thank you, hello, or I love you, custom greeting cards are thoughtful gifts that are always the perfect way to express yourself.

  • Dimensions: 12.7 cm x 17.78 cm (portrait); 17.78 cm x 12.7 cm (landscape)
  • Full color CMYK print process
  • Double sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Fairy Circle by Arthur Rackham Card

Fairy Circle by Arthur Rackham Card

The fairies are celebrating. It is for A Midsummer Night's Dream. The colours are great. It is public domain.

Customer Reviews

4.9 out of 5 stars rating19K Total Reviews
17743 total 5-star reviews818 total 4-star reviews164 total 3-star reviews89 total 2-star reviews200 total 1-star reviews
19,014 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Pat M.1 September 2025Verified Purchase
Folded Greeting Card, Size: 12,7 × 17,8 cm, Paper: Signature Matte, Envelopes: White
Thank you Colana for the perfect custom made Mass Card. It's for my brother-in-law's birthday on 5th October, St. Faustina's Feast day! So very pleased with quality of the card and the personalisation - really beautiful! Shower of Roses Shoppe is my go to for future cards and highly recommend. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By MARWA A.23 October 2021Verified Purchase
Folded Greeting Card, Size: 12,7 × 17,8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I think it’s great how you can design your own cards and buy them and they’re not even expensive which is really good. The printing turned even better than I expected
5.0 out of 5 stars rating
5 out of 5 stars rating
By NICHOLAS H.1 March 2022Verified Purchase
Folded Greeting Card, Size: 12,7 × 17,8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
So pleased with the quality, absolutely spot on. It was very easy to design my layout, colour options and font, (and i'm an old boy!!). Will definatley use again for all sorts of layouts. Printing was flawless with deep colours

Tags

Folded Greeting Cards
fairiesfairyartarthurrackhamshakespearetreeplaywhite
All Products
fairiesfairyartarthurrackhamshakespearetreeplaywhite

Other Info

Product ID: 256603442933343167
Created on 19/03/2019, 21:05
Rating: G