Tap / click on image to see more RealViewsTM
£3.41
per card
 

Fairy Circle by Arthur Rackham Card

Qty:
Choose Your Format
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+£0.60
-£0.15

Other designs from this category

About Folded Greeting Cards

Sold by

Size: Standard, 12.7 cm x 17.8 cm

Thank you, hello, or I love you, custom greeting cards are thoughtful gifts that are always the perfect way to express yourself.

  • Dimensions: 12.7 cm x 17.78 cm (portrait); 17.78 cm x 12.7 cm (landscape)
  • Full color CMYK print process
  • Double sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Fairy Circle by Arthur Rackham Card

Fairy Circle by Arthur Rackham Card

The fairies are celebrating. It is for A Midsummer Night's Dream. The colours are great. It is public domain.

Customer Reviews

4.9 out of 5 stars rating18.2K Total Reviews
17011 total 5-star reviews789 total 4-star reviews144 total 3-star reviews73 total 2-star reviews136 total 1-star reviews
18,153 Reviews
Reviews for similar products
5 out of 5 stars rating
By Pat M.1 September 2025Verified Purchase
Folded Greeting Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Thank you Colana for the perfect custom made Mass Card. It's for my brother-in-law's birthday on 5th October, St. Faustina's Feast day! So very pleased with quality of the card and the personalisation - really beautiful! Shower of Roses Shoppe is my go to for future cards and highly recommend. .
5 out of 5 stars rating
By Gary C.17 January 2021Verified Purchase
Folded Greeting Card, Size: Small, 10.2 cm x 14.2 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I Design It And So Perfect 😍👌🏼 That What I ask For. Printing It So Good And Perfect 😍👌🏼
5 out of 5 stars rating
By MARWA A.23 October 2021Verified Purchase
Folded Greeting Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I think it’s great how you can design your own cards and buy them and they’re not even expensive which is really good. The printing turned even better than I expected

Tags

Folded Greeting Cards
fairiesfairyartarthurrackhamshakespearetreeplaywhite
All Products
fairiesfairyartarthurrackhamshakespearetreeplaywhite

Other Info

Product ID: 256603442933343167
Created on 19/03/2019, 21:05
Rating: G