Tap / click on image to see more RealViewsTM
£42.55
per round throw cushion
 

Fairytale Royal Carriage Glass Slipper Pumpkin Round Cushion

Qty:

About Round Cushions

Sold by

Size: Round throw cushion 41 cm

Zazzle cushions now come in even more sizes and shapes! Make a statement without having to say a word when you accent your home with fully customisable cushions from Zazzle. Made from high-quality fabric, these soft cushions look great with your personalised designs, quotes monograms, and photos. The perfect complement to your living room, bedroom, and more!

  • Dimensions: 40.6 cm diameter (flat), 35.5 cm (stuffed)
  • Hidden zipper enclosure; synthetic-filled insert included
  • Made in the USA
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 40.6 cm (16" x 16"). For best results please add 1.9 cm (3/4") bleed..

Fabric: Brushed Polyester

  • 100% brushed polyester is wrinkle free
  • Vibrant colours help designs really pop
  • Heavy cotton-blend-type texture makes fabric soft to the touch
  • High tensile strength fabric make for long lasting quality
  • Inserts are hypoallergenic and filled with a faux down polyester fiber
  • Machine washable, able to retain colour and resist shrinkage

About This Design

Fairytale Royal Carriage Glass Slipper Pumpkin Round Cushion

Fairytale Royal Carriage Glass Slipper Pumpkin Round Cushion

Fairytale Princess theme feather topped carriage, slipper on a pillow & pumpkin motif in colours of ivory, blush pink and aqua blue.

Customer Reviews

4.6 out of 5 stars rating313 Total Reviews
244 total 5-star reviews41 total 4-star reviews15 total 3-star reviews4 total 2-star reviews9 total 1-star reviews
313 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jane T.29 April 2022Verified Purchase
Grade A Cotton Round throw cushion 41 cm
Creator Review
I have wanted to buy this for a while and snapped it up with a 40% discount code, the round pillow compliments the sleeping curled up rat. I have it at the end of my bed and I keep thinking it's a real rat when I first wake up. Printing is excellent, I feel confident it will survive washing.
5 out of 5 stars rating
By Nancy M.27 September 2020Verified Purchase
Brushed Polyester Round throw cushion 41 cm
Zazzle Reviewer Program
This custom cushion was perfect. It was just what I wanted and it arrived very quickly! I am never disappointed with anything that I purchase from Zazzle! The quality of the printing was excellent! So clear and precise!
5 out of 5 stars rating
By c.4 April 2023Verified Purchase
Brushed Polyester Round throw cushion 41 cm
Zazzle Reviewer Program
lovely quality item , lovely seller thank you. Perfect, just perfect

Tags

Round Cushions
fairytalecarriagecoachpumpkinglass slipperfeminineelegantpastelgirlypink
All Products
fairytalecarriagecoachpumpkinglass slipperfeminineelegantpastelgirlypink

Other Info

Product ID: 256120776374444500
Created on 23/08/2020, 10:07
Rating: G