Tap / click on image to see more RealViewsTM
£18.90
per keychain
 

Family Time , Family Adventure Key Ring

Qty:
Circle (single-sided)

Other designs from this category

About Key Chains

Sold by

Shape: Circle (single-sided)

Never leave home without your favourite photo, design, or inspirational message attached to your keys with this custom circle key ring. Designed to withstand daily wear and tear, this key ring displays designs, text, and photos in vibrant clarity and brilliant colours.

  • Dimensionen: 5 cm diameter (2")
  • Made of ultra-durable acrylic
  • UV resistant and waterproof
Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 5 cm x 5 cm (2" x 2"). For best results please add 0.15 cm (.12") bleed..

About This Design

Family Time , Family Adventure  Key Ring

Family Time , Family Adventure Key Ring

Keep your keys organised and add a touch of wanderlust to your everyday life with the "Family Time Travel" Key Chain. Designed with a beautiful and inspiring motif, this key chain celebrates the spirit of family and vacation travelling. Whether you're unlocking the door to your home or embarking on a new adventure, this key chain will serve as a constant reminder of the joy of exploring new destinations with your loved ones. Carry your keys with style and let your wanderlust shine wherever you go.

Customer Reviews

4.8 out of 5 stars rating966 Total Reviews
859 total 5-star reviews76 total 4-star reviews14 total 3-star reviews7 total 2-star reviews10 total 1-star reviews
966 Reviews
Reviews for similar products
5 out of 5 stars rating
By Janice R.2 August 2021Verified Purchase
Zazzle Reviewer Program
The product is lovely, very well made & I'm delighted with it. The printing and colours were as shown on the image, again just delighted with this item.
5 out of 5 stars rating
By Dilani D.19 October 2022Verified Purchase
Acrylic Key Ring, Circle (single-sided)
Zazzle Reviewer Program
I love this. I own this truck a 1939 Chevy. Its the same color and my keys are now as fancy as my "Ruby Girl". Great. Could be a little sharper and brighter in color but great
from zazzle.com (US)
5 out of 5 stars rating
By Joyce S.13 November 2021Verified Purchase
Zazzle Reviewer Program
We wanted a camping themed keychain for the keys to our new RV, but they're as scarce as hen's teeth. Then I found the Zazzle site, and what a find it was! Plenty of choices from styles to colors, printing/personalization to materials available meant we could get something perfect for us. This will be used for the spare set of keys, so we don't expect too much trouble with wear and tear. The acrylic is plenty thick (maybe 1/4"), so durability appears good. We're so happy with this purchase that we're planning on buying another one for our primary keys ... this time with a photo of our actual RV. Zazzle for the win! With a plethora of font and color choices, it's hard to imagine a customer not being able to find what they want. The font and colors are exactly what we wanted, and the printing is clear. The quality is top notch.
from zazzle.com (US)

Tags

Key Chains
familyvacationtravelkeychainadventureawaitswanderlustexploretogethertravelwithfamilyvacationmodekeychainfamilytimetravelaccessories
All Products
familyvacationtravelkeychainadventureawaitswanderlustexploretogethertravelwithfamilyvacationmodekeychainfamilytimetravelaccessories

Other Info

Product ID: 256666771340271513
Created on 10/06/2023, 5:00
Rating: G