Tap / click on image to see more RealViewsTM
£8.78
£4.39 each
 

First Fibonacci Plaid Nerdy Math Tartan Pencil

Qty:
Heads-up!
Sorry, this product has been discontinued

About Pencils

Sold by

About This Design

First Fibonacci Plaid Nerdy Math Tartan Pencil

First Fibonacci Plaid Nerdy Math Tartan Pencil

Plaid for math fans. This blue and green plaid pattern was created by converting the numbers of the Fibonacci sequence into hexadecimal and using those as the hex codes for the colour then using the Fibonacci sequence to define the strand count.

Customer Reviews

5.0 out of 5 stars rating5 Total Reviews
5 total 5-star reviews0 total 4-star reviews0 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
5 Reviews
Reviews for similar products
5 out of 5 stars rating
By Melody T.2 April 2023Verified Purchase
Zazzle Reviewer Program
Quality pencil, design, and printing. I was looking for more ways to include younger children in the St. Patrick's Day celebration. Having a pencil (amongst stickers and more) did just that. It looks even better in person. My granddaughter loved receiving her name on it also. My granddaughter also loves sparkly things. The shipping time and notifications were great. I'd recommend, this if you'd like to find a unique and/or special small gift to help your child/grandchild to celebrate this St. Patrick's Day holiday. Thank you. The design and the printing were both excellent. It was a gift and the recipient, my granddaughter loved it. Thank you.
from zazzle.com (US)
Original product
5 out of 5 stars rating
By Melody T.16 January 2023Verified Purchase
Pencil
Zazzle Reviewer Program
This is a great pencil to encourage that special person in your life as they go to school. I purchased it for my granddaughter and she loved it. The seller is great and the shipping time is also great. I love this dark pink color, the unicorn design and the personalization on the pencil too. I highly recommend this pencil to others looking for a special back to school gift or even an add on birthday personalized gift. I highly recommend this pencil. The printing turned out very well. I was totally pleased with the pencil design and personalization. My granddaughter was also. Thank you.
from zazzle.com (US)
5 out of 5 stars rating
By michelle r.8 June 2023Verified Purchase
Pencil
Zazzle Reviewer Program
My kid loved these pencils. Pretty good printing
from zazzle.com (US)

Tags

Pencils
fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright
All Products
fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright

Other Info

Product ID: 256730009839562478
Created on 01/03/2016, 10:14
Rating: G