Tap / click on image to see more RealViewsTM
£4.70
per bumper sticker
 

Funny Keep Honking Vinyl Bumper Sticker

Qty:

Other designs from this category

About Bumper Stickers

Sold by

Style: Bumper Sticker

Entertain the cars sitting behind you in traffic with a custom bumper sticker. Make your car a reflection of you and your personality, show off your particular politics, or brag about your honour roll child! Get your point across with this quality bumper sticker that will outlast heavy rain, intense sunlight, and the most severe of traffic jams.

  • Dimensions: 28 cm x 7.7 cm (3"l x 11"w)
  • Made from durable vinyl with a strong adhesive back that will hold up under the most severe of conditions
  • 100% weatherproof
  • Printed with water-resistant ink that won’t fade or run

About This Design

Funny Keep Honking Vinyl Bumper Sticker

Funny Keep Honking Vinyl Bumper Sticker

Add some sarcasm to your ride with our "Keep Honking, I Love Meaningless Feedback" vinyl bumper sticker – the perfect way to express your dry wit while stuck in traffic. This funny bumper sticker is ideal for drivers who appreciate a little roadside humour and aren’t afraid to show it. Crafted from durable, weatherproof vinyl, this high-quality car sticker is designed to withstand sun, rain, and whatever else the road throws at it. Whether you’re commuting, road-tripping, or just parked at the grocery store, this funny vinyl decal will definitely turn heads and spark a few chuckles. Perfect for: 🚗 Cars, trucks, and SUVs 💻 Laptops, water bottles, toolboxes 🎁 Gag gifts, stocking stuffers, or white elephant exchanges Product Features: Bold black & white design for maximum readability Easy peel-and-stick application Removable without residue Measures approx. 8" x 3" Show the world you’ve got a sense of humour (and a little bit of sass) with this hilarious bumper sticker. Because let’s face it—honking rarely helps, but sarcasm always does.

Customer Reviews

4.8 out of 5 stars rating3.6K Total Reviews
3171 total 5-star reviews328 total 4-star reviews60 total 3-star reviews35 total 2-star reviews36 total 1-star reviews
3,630 Reviews
Reviews for similar products
5 out of 5 stars rating
By Geoffrey D.31 August 2023Verified Purchase
Bumper Sticker
Zazzle Reviewer Program
I have bought many products from zazzle All of them have been of the highest quality with quick delivery 5 stars for zazzle. Excellent printing and colour
5 out of 5 stars rating
By Jon H.30 October 2025Verified Purchase
Bumper Sticker
Excellent sticker fast delivery .
5 out of 5 stars rating
By Anonymous25 July 2025Verified Purchase
Bumper Sticker
I’ve had some kind of Angel bumper sticker on my cars for as long as I can remember, & a glass Angel hanging inside. Zazzle is my go to place always as I can rely on them & can choose my own wording in nice Script or whatever so they feel unique to me personally. .

Tags

Bumper Stickers
funnybumperstickersarcasticcardecalvinylkeephonkingwitty
All Products
funnybumperstickersarcasticcardecalvinylkeephonkingwitty

Other Info

Product ID: 256560544047715042
Created on 08/06/2025, 16:52
Rating: G