Tap / click on image to see more RealViewsTM
Sale Price £20.19.  
Original Price £23.75 per shirt
You save 15%

Future Doctor Baby Bodysuit

Qty:
Baby Jersey Bodysuit
-£3.15
White
Classic Printing: No Underbase
Vivid Printing: White Underbase
+£4.10
+£4.10
+£4.10
+£4.10

Other designs from this category

About T-Shirts

Sold by

Style: Baby Jersey Bodysuit

Not all baby bodysuits are created equal – this popular style is a must-have for your precious little bundle. The neckband is designed for easy on-and-off and a three-snap closure makes diaper changes a cinch. Personalise it with a custom image or message or dress it up with a cute pair of socks and hat or hair accessory. There's no wrong way to wear this super soft bodysuit.

Size & Fit
  • Standard fit
  • Garment is unisex sizing
  • Flatlock seams, reinforced three snap closure
  • Fits true to size
Fabric & Care
  • 127g, 100% combed ring spun cotton (Heather is 93/7) jersey
  • Double-needle ribbed binding on all openings
  • EasyTear™ label
  • White is sewn with 100% cotton thread
  • Machine washable. Washing before first use is recommended
Fully committed to providing high quality and safe products, all Zazzle baby products are Consumer Product Safety Improvement Act (CPSIA) compliant. Tracking label available in side seam.

About This Design

Future Doctor Baby Bodysuit

Future Doctor Baby Bodysuit

Future Doctor with stethoscope motif. Nice gifts!

Customer Reviews

4.6 out of 5 stars rating2.6K Total Reviews
1957 total 5-star reviews410 total 4-star reviews105 total 3-star reviews44 total 2-star reviews40 total 1-star reviews
2,556 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Gavin G.8 August 2019Verified Purchase
Baby Jersey Bodysuit, White, 12 to 18 Month
Zazzle Reviewer Program
Was exactly as described. Maybe a little small for a bigger newborn but did fit just right for a 6lb baby. Would definitely purchase again. Good quality printing.
5.0 out of 5 stars rating
5 out of 5 stars rating
By K.25 November 2020Verified Purchase
Baby Jersey Bodysuit, White, Newborn
Zazzle Reviewer Program
Nice quality, perfect for a baby shower gift. Just as ordered, clear and good size letters
5.0 out of 5 stars rating
5 out of 5 stars rating
By Susan C.7 January 2024Verified Purchase
Baby Jersey Bodysuit, White, 3 to 6 Month
Zazzle Reviewer Program
Her Daddy who played guitar and looked after her since she was born, baby now 18 months, died of fatal heart attack recently. We wanted her to have a special gift at Xmas to remember him and I ordered this lovely Cinco De Mayo floral guitar outfit with her name on it. Very pretty and hopefully a keepsake if she doesn’t wear it out. Very well printed and looks lovely

Tags

T-Shirts
doctorfuture doctorphysicianmedicalchildrenkidsinfantshospitalnew babybaby shower
All Products
doctorfuture doctorphysicianmedicalchildrenkidsinfantshospitalnew babybaby shower

Other Info

Product ID: 235157508766142999
Created on 14/10/2021, 16:00
Rating: G