Tap / click on image to see more RealViewsTM
£35.20
per window cling
 

Generic Customise Fried Crispy Chicken 2 Door Window Cling

Qty:
Custom (18.00" x 23.40")
Automatic Opaque Design: White Underbase
Custom Cut

Other designs from this category

About Window Clings

Sold by

Shape: Custom Cut

Turn your glass surfaces into decorations, promotions, signage and more with custom window clings. These versatile and reusable vinyl clings stick to glass surfaces through static electricity so leave no sticky residue behind. From displaying new promotions on your business’s window and using that empty window space to boost your brand, to decorating a window in your home, you’ll find so many great uses for these clings.

  • Dynamically Sized - ranging from 10cm x 10cm to a max of 132cm x 183cm (or max 183cm x 132cm if horizontal/landscape is selected)
  • Material - 7.5 mil static cling vinyl
  • Non Adhesive: Sticks to glass surfaces electro-statically
  • Choose from rectangle or custom cut shapes

Application Instructions:

  • Clean the surface you wish to apply the window cling to with hot water and dishwasher soap and wait until dry
  • Next, apply a light mist of water to your surface. Peel the decal from backing paper and place it on your surface, slide it around until you’re happy with its placement
  • Once it’s positioned perfectly, use a squeegee or flat plastic card to remove any air bubbles and wipe your window dry
  • To reposition or remove, simply peel away. It’s non-adhesive so there’ll be no residue left on the surface

Print Process: Automatic Opaque Design: White Underbase

Art is printed on a transparent sheet of plastic, but white ink is printed beneath all art, making those areas opaqaue while also making colors vivid

Adhesive: Cling art faces outwards

The adhesive side is on the front of the window cling. All text and art are printed on the front of the window cling and face away from the person applying it to the window. The art and text printed on the window cling will appear correctly when viewed from the opposite side of the window where it has been applied.

About This Design

Generic Customise Fried Crispy Chicken 2 Door Window Cling

Generic Customise Fried Crispy Chicken 2 Door Window Cling

I created this Generic Customise Fried Crispy Chicken 2 Front Window Cling for convenience, corner stores and gas stations that sell chicken to their customers. I used the Mister Earl font with a shadow to give the design some down home character. I will be adding several smaller sizes of this design to my Convenience Corner Store Banners & Signs collection. That way you don't have to play with the sizing.

Customer Reviews

3.6 out of 5 stars rating232 Total Reviews
133 total 5-star reviews13 total 4-star reviews7 total 3-star reviews15 total 2-star reviews64 total 1-star reviews
232 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By mmmm A.29 August 2022Verified Purchase
Window Cling, Size: 8.00" x 11.00", Style: Partial Transparent Design: No Underbase, Shape: Custom Cut, Display: Back of Cling
Zazzle Reviewer Program
It was really easy to order this window cling for my business. Just uploaded my logo, picked the size etc and it turned up really promptly. Super easy to fit and it looks great! Excellent price as well! I'll definitely be back for more for my car! Perfect printing! All the colours were spot on and they really pop!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Mr R.7 December 2022Verified Purchase
Window Cling, Size: 20.00" x 30.00", Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Back of Cling
Zazzle Reviewer Program
good quality product. good quality print
5.0 out of 5 stars rating
5 out of 5 stars rating
By In S.28 December 2024Verified Purchase
Window Cling, Size: 4.00" x 4.00", Style: Partial Transparent Design: No Underbase, Shape: Custom Cut, Display: Back of Cling
Sharp detail print with bright colors. Looks good.

Tags

Window Clings
chicken front window clinggenericcustomisefriedcrispychickensignpersonalise fried chicken signcustomise chicken front door sign
All Products
chicken front window clinggenericcustomisefriedcrispychickensignpersonalise fried chicken signcustomise chicken front door sign

Other Info

Product ID: 256684242142617508
Created on 22/06/2022, 10:15
Rating: G