Tap / click on image to see more RealViewsTM
£20.45
per roll
 

Giftwrap: Jolly Santa Wrapping Paper

Qty:

Other designs from this category

About Wrapping Paper

Sold by

Paper Finish: Matte Wrapping Paper

Make sure every gift you give has a layer of love by creating custom wrapping paper. Available in four types of premium paper and five different sizes, our wrapping paper covers all your gift wrapping needs - because presentation matters as much as the gift!

  • 64lb print quality matte paper
  • Ideal for printing photos
  • Full colour edge-to-edge printing
  • Width: 74 cm
  • Length: multiple options from 1.8 m to 18.3 m
  • Each roll up to 4.6 m in length; lengths greater than 4.6 m shipped as multiple 4.6 m rolls
  • Length guide:
    • 1.8 m roll wraps 3 shirt-sized boxes
    • 4.6 m roll wraps 9 shirt-sized boxes
    • 9.1 m roll wraps 18 shirt-sized boxes
    • 13.7 m roll wraps 27 shirt-sized boxes
    • 18.3 m roll wraps 36 shirt-sized boxes
  • Designable area is 91 x 76 cm, but scaled down uniformly and printed at 88.4 x 73.7 cm
  • Please note: Designs are tiled after first 88.4 x 73.7 cm printed section

About This Design

Giftwrap:  Jolly Santa Wrapping Paper

Giftwrap: Jolly Santa Wrapping Paper

This giftwrap was designed with free public domain vintage artwork.

Customer Reviews

4.7 out of 5 stars rating4.2K Total Reviews
3470 total 5-star reviews380 total 4-star reviews115 total 3-star reviews77 total 2-star reviews114 total 1-star reviews
4,156 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jan T.18 August 2025Verified Purchase
Wrapping Paper, Matte Wrapping Paper
I love this paper and it was large enough to put on the back of a glazed cabinet. It’s had lots of comments. I painted the interior to extend the image and it was very pleased with the result.
5 out of 5 stars rating
By Julia M.24 May 2017Verified Purchase
Zazzle Reviewer Program
I really liked this product, the picture is lovely and the colours are really nice. I wanted it to up-cycle a writing bureau and I was concerned that the paper may be too thin. But it wasn't and it worked fine. On the pictures I have uploaded the print looks a bit aged and not so vivid and new looking. As I wanted an aged patina but the actual print is clearer and the colours are brighter. The colour and prints are good.
Original product
5 out of 5 stars rating
By B.20 October 2017Verified Purchase
Wrapping Paper, Matte Wrapping Paper
Zazzle Reviewer Program
Very strong quality paper used. I used it to cover a lampshade, and it looks stunning now. Vibrant and vivid. Such lovely colours.

Tags

Wrapping Paper
santajollychristmasxmasvchdgiftwrapwrappaperwrapping
All Products
santajollychristmasxmasvchdgiftwrapwrappaperwrapping

Other Info

Product ID: 256561890783440174
Created on 21/08/2018, 15:17
Rating: G