Tap / click on image to see more RealViewsTM
Sale Price £9.68.  
Original Price £12.10 per sheet of 6
You save 20%

Glitch: achievement better bubble farmer classic round sticker

Qty:
Classic Round Stickers
+£0.45
+£0.45
+£0.45

Other designs from this category

About Stickers

Sold by

Shape: Classic Round Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Glitch: achievement better bubble farmer classic round sticker

Glitch: achievement better bubble farmer classic round sticker

Glitch: achievement better bubble farmer This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating27.5K Total Reviews
23775 total 5-star reviews2247 total 4-star reviews585 total 3-star reviews369 total 2-star reviews560 total 1-star reviews
27,536 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Natalie H.14 December 2021Verified Purchase
Zazzle Reviewer Program
I’m very happy with my stickers they are perfect for labelling my candles. Customer service and the prices have always been spot on. I would highly recommend. I love the colour and wording on my stickers
5.0 out of 5 stars rating
5 out of 5 stars rating
By Sally M.6 April 2022Verified Purchase
Zazzle Reviewer Program
I was really pleased with the stickers and the design, they are exactly what I was looking for. Delivered on time and good value. Colours look great and printing good quality.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Rebecca B.27 February 2024Verified Purchase
Zazzle Reviewer Program
Such great quality stickers for my candles Perfect size, very happy with these ⭐️⭐️⭐️⭐️⭐️. Excellent printing quality and colour

Tags

Stickers
achievementbetterbubblefarmerglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementbetterbubblefarmerglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 217097539878478632
Created on 06/10/2014, 16:16
Rating: G